ESTScan Details for Unigene SGN-U207536

Score 
346
Direction 
Forward
Predicted Peptide Sequence 
MARSICFFAVAILALMLFAAYDAEAATCKAECPTWDSVCINKKPCVAVAKRQSSLMGTAAKYSEDVCALKSXVFEKTEATQTETFTKDVN
TLAEALLEADMMV
Predicted Coding Sequence 
ATGGCTCGCTCCATCTGTTTCTTCGCAGTTGCTATACTAGCATTGATGCTCTTTGCTGCCTATGACGCAGAAGCGGCAACTTGCAAGGCT
GAATGCCCAACATGGGATTCCGTCTGTATCAATAAAAAACCATGTGTAGCTGTTGCAAAAAGGCAAAGTTCTCTGATGGGCACTGCAGCA
AAATACTCAGAAGATGTCTGTGCACTAAAGAGTGXTGTATTCGAAAAAACTGAGGCAACTCAAACAGAAACTTTCACTAAGGATGTAAAC
ACTTTGGCTGAAGCTTTGCTTGAAGCAGATATGATGGTGTAA\
Edits in Original Sequence 
CTTTCTAAAAAAACATTTGCTTATTATTTACTTGTGTTCACTGTTGTACACTTTGCTACT(5')ATGGCTCGCTCCATCTGTTTCTTCGC
AGTTGCTATACTAGCATTGATGCTCTTTGCTGCCTATGACGCAGAAGCGGCAACTTGCAAGGCTGAATGCCCAACATGGGATTCCGTCTG
TATCAATAAAAAACCATGTGTAGCgTGTTGCAAAAAGGCAAAGTTCTCTGATGGGCACTGCAGCAAAATACTCAGAAGATGTCTGTGCAC
TAAAGAGTGXTGTATTCGAAAAAACTGAGGCAACTCAAACAGAAACTTTCACTAAGGATGTAAACACTTTGGCTGAAGCTTTGCTTGAAG
CAGATATGATGGTGTAA\(3')GAGATTACTTATTAGGGCTGTATGTGTCGCACAAAAATGTGTTGCCCTCGATAGAGGATGACTCACTT
TAATTTTCTATTCTATTTGATGTTTATCTTGTATCTTTGGCTTTACTAGCCTCTTGTTATAACAAAATAAGTGTGACACGTCCTAATTTG
AAGCTCTATTTTTATGAATGATGTATCCAATTTGTGAGTTATTTTATTTAATCTAAAGTACTTTTTATGGGTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan