Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U207537

Score 
291
Direction 
Forward
Predicted Peptide Sequence 
MARSICFFAVATLALMLFAAYEAEAATCKAECPTWDGICINKGPCVKCCKAQPEKFTEGTAVKYSEDAYALSRXATEEATATLANEVKTM
AEALVEEDMME
Predicted Coding Sequence 
ATGGCTCGCTCCATCTGTTTCTTCGCAGTTGCTACACTGGCATTGATGCTCTTTGCTGCCTATGAGGCGGAAGCGGCAACTTGCAAGGCT
GAATGCCCAACTTGGGATGGAATATGTATAAATAAAGGCCCATGTGTAAAATGTTGCAAAGCACAACCAGAAAAATTCACAGAGGGCACT
GCAGTAAAGTACTCCGAAGATGCCTATGCACTAAGCCGTGXTGCAACTGAAGAGGCAACTGCAACTTTGGCTAACGAGGTAAAGACTATG
GCTGAAGCTTTGGTCGAAGAAGATATGATGGAATAA\
Edits in Original Sequence 
AAAACATTTGGTTATTATTTACTTGTGTTCACTGTAGTACACTTTGCTACT(5')ATGGCTCGCTCCATCTGTTTCTTCGCAGTTGCTAC
ACTGGCATTGATGCTCTTTGCTGCCTATGAGGCGGAAGCGGCAACTTGCAAGGCTGAATGCCCAACTTGGGATGGAATATGTATAAATAA
AGGCCCATGTGTAAAATGTTGCAAAGCACAACCAGAAAAATTCACAGAcGGGCACTGCAGTAAAGTACTCCGAAGATGCCTATGCACTAA
GCCGTGXTGCAACTGAAGAGGCAACTGCAACTTTGGCTAACGAGGTAAAGACTATGGCTGAAGCTTTGGTCGAAGAAGATATGATGGAAT
AA\(3')GAGATTACTTGTATGTGTCACACACAAGTATAGTCCTCTATATATAGAGGATCATGGTTCAGTTTCCTAGTGTTTGATGTTTG
TATTATGTTCTTGGCTTTATAAGTAGCCCTTTGTTAATTGAATAAGTGTGACACATCCTCTTTATGGAGCTCTATATATCCAAATTTATG
GTTTTATTTTAAACAATTAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan