ESTScan Details for Unigene SGN-U207562

Score 
510
Direction 
Forward
Predicted Peptide Sequence 
TQWNLDFTEHSEQVIGTXELANRVDEALGFMNAAGLTTDHPIMTTTEFWTSHECLPLPYEQSLTRLDSTSGLYYDCSAHFLWVGERTRQL
DGAHVEFLRGIANPLGIKVSDKMDPSALVKLIEILNPQNKAGRITIITRMGAENMRVKLPHLIRAVRGAGQIVTWVSDPMHGNTIKAPCG
LKTRPFDSIRAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLSSRYHTHCDPRLNASQSLELAFIIAEALEKGDLDHK
AVRSIDTWKGSNAVFLVLLLQLNYEWMS
Predicted Coding Sequence 
ACTCAATGGAACTTGGATTTCACAGAGCATAGTGAGCAGGTGATAGGTACCGAXGAACTAGCTAACAGAGTGGATGAGGCCCTTGGGTTC
ATGAATGCTGCTGGACTTACAACGGACCATCCTATCATGACAACCACCGAGTTCTGGACATCTCATGAGTGCTTACCTTTGCCCTATGAG
CAGTCACTAACTCGATTGGATTCGACTTCTGGCCTTTACTATGATTGCTCTGCCCATTTTCTTTGGGTTGGAGAGAGAACTAGGCAGTTG
GATGGTGCCCATGTCGAGTTCTTGAGAGGAATCGCCAACCCCCTTGGTATTAAGGTGAGTGACAAGATGGACCCAAGTGCATTGGTCAAG
CTCATTGAGATTTTGAACCCTCAAAACAAGGCTGGTAGAATTACAATAATTACCAGAATGGGAGCAGAAAACATGAGGGTTAAGCTTCCT
CATCTTATCAGGGCTGTCCGAGGAGCAGGGCAAATTGTCACTTGGGTATCTGATCCTATGCATGGAAATACCATCAAAGCTCCGTGTGGT
CTTAAAACTCGACCTTTCGATTCCATCAGGGCTGAAGTAAGAGCATTCTTTGATGTTCATGAACAAGAAGGAAGCCACCCAGGAGGAGTG
CACCTTGAGATGACTGGTCAAAACGTCACAGAGTGCATCGGTGGATCAAGAACTGTGACCTTCGATGATCTGAGCTCACGTTACCACACC
CACTGTGATCCTAGGCTCAACGCATCTCAATCCCTTGAACTCGCGTTCATTATTGCAGAAGCCTTAGAAAAAGGAGACTTGGATCACAAA
GCTGTTAGGTCAATAGATACGTGGAAAGGTTCAAATGCTGTTTTCTTGGTTTTACTTCTTCAACTAAACTATGAATGGATGTCTTAA\
Edits in Original Sequence 
(5')ACTCAATGGAACTTGGATTTCACAGAGCATAGTGAGCAGGTGATAGGTACCGAXGAACTAGCTAACAGAGTGGATGAGGCCCTTGG
GTTCATGAATGCTGCTGGACTTACAACGGACCATCCTATCATGACAACCACCGAGTTCTGGACATCTCATGAGTGCTTACCTTTGCCCTA
TGAGCAGTCACTAACTCGATTGGATTCGACTTCTGGCCTTTACTATGATTGCTCTGCCCATTTTCTTTGGGTTGGAGAGAGAACTAGGCA
GTTGGATGGTGCCCATGTCGAGTTCTTGAGAGGAATCGCCAACCCCCTTGGTATTAAGGTGAGTGACAAGATGGACCCAAGTGCATTGGT
CAAGCTCATTGAGATTTTGAACCCTCAAAACAAGGCTGGTAGAATTACAATAATTACCAGAATGGGAGCAGAAAACATGAGGGTTAAGCT
TCCTCATCTTATCAGGGCTGTCCGAGGAGCAGGGCAAATTGTCACTTGGGTATCTGATCCTATGCATGGAAATACCATCAAAGCTCCGTG
TGGTCTTAAAACTCGACCTTTCGATTCCATCAGGGCTGAAGTAAGAGCATTCTTTGATGTTCATGAACAAGAAGGAAGCCACCCAGGAGG
AGTGCACCTTGAGATGACTGGTCAAAACGTCACAGAGTGCATCGGTGGATCAAGAACTGTGACCTTCGATGATCTGAGCTCACGTTACCA
CACCCACTGTGATCCTAGGCTCAACGCATCTCAATCCCTTGAACTCGCGTTCATTATTGCAGAAcGCCTTAGAAAAAGGAGACTTGGATC
ACAAAGCgTGTTAGGTCAATAGATACGTGGAAAGGTTCAAATGCTGTTTTCTTGGTTTTACTTCTTCAACTAAACTATGAATGGATGTCT
TAA\(3')TATTTACATTTTTTTTTTCAAAGACCAATTTGGTGGATATGTTATGTTTGCACTGTATTCATACTATAGAAGAGAGTGTTAT
AATGTATGAGAGTTTGGTGACCAAGGAATAAAGCAAGGAAGTTACTCTATCATAGTACGTCTATTGAAATTATATATTTGAAGTGGCTGT
GCTACAGGTGCATATGTATCATCTGCAACACATGTTATTCAAAGACAACGTGATGTTTCTCACGTACTGTACTTTTTCTAAAAAAAAAAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan