ESTScan Details for Unigene SGN-U207735

Score 
476
Direction 
Forward
Predicted Peptide Sequence 
MSSAMNDDDFNVRKSQLSGYDRLSCEGGSPMKMSPWNQSCHINDLDMYKSCDEDDGSQNDSKICLIGSLVREEGHIYSLATKNDLLYTGS
DSKNIRVWKNMKEFSAFKSNSGLVKAIIISGDKIFTGHQDGKVRVWKVQPNNPSIHKSAGTLPTFFDIFKASIRPSNYFMSAKHSKASIW
IKHWX
Predicted Coding Sequence 
ATGTCCTCTGCAATGAATGATGACGATTTCAACGTACGTAAAAGCCAGTTATCTGGCTATGATCGTCTTAGTTGTGAAGGTGGTTCTCCT
ATGAAAATGTCACCATGGAACCAAAGTTGTCATATTAATGATCTCGACATGTATAAATCATGTGATGAGGATGATGGTTCGCAAAATGAC
TCCAAGATTTGTCTCATTGGTTCACTTGTTCGTGAAGAAGGCCATATATATTCTTTGGCTACAAAAAATGATCTTCTTTATACAGGTTCT
GATAGCAAAAATATACGTGTATGGAAGAATATGAAGGAGTTTTCGGCTTTTAAATCTAATAGTGGTCTTGTTAAAGCCATTATCATTTCT
GGAGACAAGATTTTTACCGGTCATCAAGATGGAAAAGTTCGAGTATGGAAGGTACAACCTAATAATCCTAGCATTCACAAATCTGCTGGA
ACTTTACCAACATTCTTTGACATTTTTAAGGCATCAATTAGGCCAAGCAACTATTTCATGTCAGCCAAACATAGCAAGGCTTCCATTTGG
ATCAAACATTGGGXX\
Edits in Original Sequence 
AGAAAATATGGCATAATACACATATACAAATAAAGAACCATCCACCATATAACTTCTTAAATTAGTAAAAAAAAAAAAAAAATACTTGGA
TCCCCATAATC
(5')ATGTCCTCTGCAATGAATGATGACGATTTCAACGTACGTAAAAGCCAGTTATCTGGCTATGATCGTCTTAGTTGT
GAAGGTGGTTCTCCTATGAAAATGTCACCATGGAACCAAAGTTGTCATATTAATGATCTCGACATGTATAAATCATGTGATGAGGATGAT
GGTTCGCAAAATGACTCCAAGATTTGTCTCATTGGTTCACTTGTTCGTGAAGAAGGCCATATATATTCTTTGGCTACAAAAAATGATCTT
CTTTATACAGGTTCTGATAGCAAAAATATACGTGTATGGAAGAATATGAAGGAGTTTTCGGCTTTTAAATCTAATAGTGGTCTTGTTAAA
GCCATTATCATTTCTGGAGACAAGATTTTTACCGGTCATCAAGATGGAAAAGTTCGAGTATGGAAGGTACAACCTAATAATCCTAGCATT
CACAAATCTGCTGGAACTTTACCAACATTCTTTGACATTTTTAAGGCATCAATTAGGCCAAGCAACTATTTCATGTCAGCCAAACATAGC
AAGGCTTCCATTTGGATCAAACATTGGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan