ESTScan Details for Unigene SGN-U207881

Score 
880
Direction 
Forward
Predicted Peptide Sequence 
MAGGKVDLDGNVIKPMTICMIGAGGFIGSHLCEKLMNETQHTVLAVDVYSDKIKHLLEAPEGSLPWTGRIHFHRINIKNDSRLEGLIKMA
DLVVNLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENGKRLIHFSTCEVYGKTVGAFLPEDSPLKQDPAYYVLKEDESPCIFGPIEK
QRWSYACAKQLIERLIYAEGAENGLEFTIEGPSTGXVPGWISFPVIDGPSEGVPRVLACFSNNLLRREPLKLVDGGHSQRTFIYIKDAIE
AVLLMIENPARANGHTFNVGNPNNEVTVRQLAEMMSQVYSKVSGEASIEVPTVDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSL
WDLLESTLTYQHRTYAEAVKQAMSKTTAN
Predicted Coding Sequence 
XATATGGCAGGAGGGAAGGTAGATCTAGATGGAAATGTGATAAAGCCAATGACAATATGCATGATAGGTGCAGGTGGTTTTATTGGGTCC
CACTTATGTGAAAAACTTATGAATGAAACACAACATACTGTCTTAGCTGTTGATGTTTATAGTGATAAAATTAAACATCTTCTTGAAGCT
CCTGAAGGTTCTTTACCTTGGACTGGTCGTATTCACTTTCATCGTATTAATATTAAGAATGATTCTAGACTTGAAGGTCTCATCAAAATG
GCAGATCTGGTGGTTAATCTTGCTGCGATCTGCACGCCAGCAGATTATAATACTCGTCCACTTGATACAATCTACAGCAACTTCATTGAT
GCTCTACCAGTGGTTAAGTACTGCTCGGAAAATGGAAAGCGTCTTATTCACTTTTCCACTTGTGAAGTCTATGGGAAAACCGTAGGTGCT
TTTTTACCTGAAGACAGCCCATTGAAGCAGGATCCTGCTTACTATGTTCTTAAGGAGGATGAATCTCCTTGCATTTTTGGACCTATTGAG
AAGCAAAGGTGGTCCTATGCCTGTGCAAAGCAATTGATTGAGAGGTTGATCTATGCTGAGGGTGCTGAGAATGGCTTAGAGTTCACCATT
GAAGGCCCTTCAACTGGATAGGTCCCAGGATGGATTTCATTCCCGGTXATTGATGGTCCTAGTGAAGGTGTTCCAAGAGTGTTGGCATGC
TTTAGTAATAACCTTTTAAGACGTGAACCACTTAAACTAGTGGACGGTGGACACTCGCAGAGAACTTTCATATATATCAAGGATGCTATT
GAAGCTGTTCTCCTGATGATTGAAAATCCTGCACGGGCCAATGGGCATACCTTTAACGTGGGCAATCCTAATAACGAAGTTACTGTTAGG
CAGCTTGCTGAAATGATGAGTCAGGTGTACTCAAAGGTGAGTGGAGAAGCTTCAATTGAAGTACCAACCGTTGATGTAAGTTCTAAAGAA
TTTTATGGCGAGGGATATGATGACAGTGACAAGCGAATTCCAGACATGACCATAATTAACAGACAACTTGGTTGGAATCCAAAGACATCC
CTATGGGACTTGCTTGAATCCACACTTACATACCAACACAGGACATATGCTGAAGCTGTCAAGCAGGCAATGTCAAAGACAACTGCCAAT
TGA\
Edits in Original Sequence 
(5')XATATGGCAGGAGGGAAGGTAGATCTAGATGGAAATGTGATAAAGCCAATGACAATATGCATGATAGGTGCAGGTGGTTTTATTGG
GTCCCACTTATGTGAAAAACTTATGAATGAAACACAACATACTGTCTTAGCTGTTGATGTTTATAGTGATAAAATTAAACATCTTCTTGA
AGCTCCTGAAGGTTCTTTACCTTGGACTGGTCGTATTCACTTTCATCGTATTAATATTAAGAATGATTCTAGACTTGAAGGTCTCATCAA
AATGGCAGATCTGGTGGTTAATCTTGCTGCGATCTGCACGCCAGCAGATTATAATACTCGTCCACTTGATACAATCTACAGCAACTTCAT
TGATGCTCTACCAGTGGTTAAGTACTGCTCGGAAAATGGAAAGCGTCTTATTCACTTTTCCACTTGTGAAGTCTATGGGAAAACCGTAGG
TGCTTTTTTACCTGAAGACAGCCCATTGAAGCAGGATCCTGCTTACTATGTTCTTAAGGAGGATGAATCTCCTTGCATTTTTGGACCTAT
TGAGAAGCAAAGGTGGTCCTATGCCTGTGCAAAGCAATTGATTGAGAGGTTGATCTATGCTGAGGGTGCTGAGAATGGCTTAGAGTTCAC
CATTGtAAGGCCCTTCAACTGGATAGGTCCCAGGATGGATTTCATTCCCGGTXATTGATGGTCCTAGTGAAGGTGTTCCAAGAGTGTTGG
CATGCTTTAGTAATAACCTTTTAAGACGTGAACCACTTAAACTAGTGGACGGTGGACACTCGCAGAGAACTTTCATATATATCAAGGATG
CTATTGAAGCTGTTCTCCTGATGATTGAAAATCCTGCACGGGCCAATGGGCATACCTTTAACGTGGGCAATCCTAATAACGAAGTTACTG
TTAGGCAGCTTGCTGAAATGATGAGTCAGGTGTACTCAAAGGTGAGTGGAGAAGCTTCAATTGAAGTACCAACCGTTGATGTAAGTTCTA
AAGAATTTTATGGCGAGGGATATGATGACAGTGACAAGCGAATTCCAGACATGACCATAATTAACAGACAACTTGGTTGGAATCCAAAGA
CATCCCTATGGGACTTGCTTGAATCCACACTTACATACCAACACAGGACATATGCTGAAGCTGTCAAGCAGGCAATGTCAAAGACAACTG
CCAATTGA\(3')GTGGAATCGGAGCAGTGCTTTAGTGTGTTCTTCATGTCGAAAGGCTTTCAAATTCTTTTTAAGAATCTTAATCCACT
CTGTTTGACTTCATACACGTATTCTTTTTGCTATCCACGTCATGCAAATCGGTAGTAGCTCACAGGTATGAGCATCATGAAGGAAGTTGT
CATATGTTGATGTAATGTCACTAGAGCCTTCAGCCACAACAGTTATCGGACATTATGTAGTCTGNTCTTAAGATTTTGTTCTCTGTCATT
CATATNGTCATTCATCTGTATGAAAGCATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan