ESTScan Details for Unigene SGN-U207907

Score 
94
Direction 
Forward
Predicted Peptide Sequence 
HLDLDAVEALIQGLVLFQGGVLMVSHDEHLISGSVDQLWAVSQGRVTPFDGNFQDYKKXTAIIMTIDPNKGGSFLKLDEVVFSWRDPYST
GIGTFKVLYRW
Predicted Coding Sequence 
XATCACTTGGATCTGGATGCTGTGGAGGCCCTGATACAAGGTCTTGTCTTGTTCCAAGGAGGCGTACTGATGGTCAGTCACGATGAACAT
TTAATATCTGGTAGTGTTGACCAACTCTGGGCTGTCTCTCAGGGAAGGGTTACACCTTTCGATGGAAACTTCCAGGATTACAAGAAAATX
ACTGCAATCATCATGACAATTGATCCTAACAAAGGTGGCTCTTTCCTGAAGTTGGACGAAGTAGTTTTTTCATGGCGTGACCCCTATAGC
ACGGGAATTGGCACTTTCAAAGTACTTTACAGATGG\
Edits in Original Sequence 
(5')XATCACTTGGATCTGGATGCTGTGGAGGCCCTGATACAAGGTCTTGTCTTGTTCCAAGGAGGCGTACTGATGGTCAGTCACGATGA
ACATTTAATATCTGGTAGTGTTGACCAACTCTGGGCTGTCTCTCAGGGAAGGGTTACACCTTTCGATGGAAACTTCCAGGATTACAAGAA
AATXACTGCAATCATCATaGACAATTGATCCTAACAAAGGTGGCTCTTTCCTGAAGTTGGACGAAGTAGTTTTTTCATGGCGTaGACCCC
TATAGCACGGGAATTGGCACTTTCAAAGTACTTTACAGATGG\(3')AATCAGAAATTTAGCTTTTTTATCTTGATTGAATGATCCATAG
TTGTGGAAGTGAATCTTTTTTTATTTTATTTATGTTTCCTTGTATAAAACCAAGGTATCTTGGATCTTCATTATGGGAGTTTCTTATTCG
AGACTGGAGTGGAGAAATGTGTCTTGAGCCATGAGAAATTTGTAATCACTTATTGTACGGGTATTGTCCACTACATCATATGATTTTGGA
GTAGTTTTTCCTTATAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan