Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U207956

Score 
372
Direction 
Forward
Predicted Peptide Sequence 
VIFAVSAENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDINLQM
QHEAELADAANQPLPDDDDETFDKSNQPSLPASXGAVVILFFFLCTGVPFFPPLMASEDSVQNM
Predicted Coding Sequence 
XXCGTGATCTTTGCCGTGTCTGCXGAGAATATTCCCATTGTTCTTTGCGGAAACAAGGTTGATGTGAAGAACCGACAAGTTAAGGCAAAG
CAGGTTACTTTCCACCGGAAGAAGAATTTGCAGTACTATGAGATATCAGCAAAGAGTAACTACAACTTTGAGAAGCCTTTCCTCTACCTT
GCAAGGAAACTCGCGGGGGATCCTAACTTGCACTTTGTGGAGTCTCCTGCCCTTGCTCCTCCTGAAGTACAAATCGACATTAATTTACAG
ATGCAGCACGAAGCCGAGCTTGCCGATGCTGCCAATCAACCCCTCCCAGATGATGATGATGAGACATTTGATAAGAGTAATCAGCCATCT
TTGCCAGCATCTGXTGGTGCAGTTGTGATTTTGTTTTTTTTCCTATGTACTGGTGTCCCATTTTTTCCACCATTGATGGCTTCCGAGGAC
TCTGTCCAGAATATGTAG\
Edits in Original Sequence 
(5')XXCGTGATCTTTGCCGTGTCTGCXGAGAATATTCCCATTGTTCTTTGCGGAAACAAGGTTGATGTGAAGAACCGACAAGTTAAGGC
AAAGCAGGTTACTTTCCACCGGAAGAAGAATTTGCAGTACTATGAGATATCAGCAAAGAGTAACTACAACTTTGAGAAGCCTTTCCTCTA
CCTTGCAAGGAAACTCGCGGGGGATCCTAACTTGCACTTTGTGGAGTCTCCTGCCCTTGCTCCTCCTGAAGTACAAATCGACATTAATTT
ACAGATGCAGCACGAAGCCGAGCTTGCCGATGCTGCCAATCAACCCCTCCCAGATGATGATGATGAGACATTTGAtTAAGAGTAATCAGC
CATCTTTGCCAGCATCTGXTGGTGCAGTTGTGATTTTGTTTTTTTTCCTATGTACTGGTGTCCCATTTTTTCCACCATTGATgGGCTTCC
GAGGACTCTGTCCAGAATATGTAG\(3')GCTTTTTGAACTCTGTTCTTGATCTATTTTCTATTTGGGTTGTGAGAAGGATATGAAGTTT
TTATTCATATCTTTTGAATATGGATCTATTTGTTTGGATGAATCTTTTTGGATAAATGGAGCTGCTGCTGTGATTGCTTATTCAAAAAAA
AAAAACAAAACAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan