ESTScan Details for Unigene SGN-U207972

Score 
1070
Direction 
Forward
Predicted Peptide Sequence 
QEIIDMCDFAVGLSRQLNGSIIPSERPNHMMLETWNPLGIVGVITAFNFPCAVLGWNACIALAVAIALSGKXAPTTPLVTIAMTKIVARV
LEKNDLPGSIFTAFCGGAEIGEAIAKDTRIPLVSFTGSSKVGLAVQQTVNQRFGKCLLELSGNNAIIVMDDADIELAVRSVLFAAVGTAG
XALYNVPETVVHETVYEKVLERLVDVYKQVKIGDPLEKGTLLGPLHTRTSRENFDKGIQNIKSQGGKILTGGSVIESEGNFVQPTIVEIS
PKAEVVKEELFAPVLYVMKFKTFKEAVEINNSVPQGLSSSIFTRNPEVIFKWIGPQGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREA
GSDSWKQYMGAQLVHSIMGMNYHWHRESILASEIGAELXRIVLRLPPWFNTHPIVLVVDPEIT
Predicted Coding Sequence 
CAAGAAATCATTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTCAATGGATCCATTATCCCTTCTGAACGCCCTAACCATATG
ATGTTGGAGACGTGGAATCCTCTTGGGATAGTTGGTGTGATCACAGCTTTCAACTTCCCATGCGCTGTACTAGGATGGAATGCATGCATT
GCACTGGCTGTGGCAATTGCGTTGTCTGGAAAGGXTGCTCCAACAACACCATTAGTTACCATAGCAATGACAAAGATCGTGGCTAGAGTA
TTGGAGAAAAACGATTTACCTGGTTCAATTTTTACTGCCTTCTGTGGTGGTGCTGAAATTGGTGAAGCAATAGCAAAAGACACAAGGATT
CCTCTAGTCTCGTTCACTGGGAGCTCAAAGGTTGGTCTTGCAGTTCAGCAAACAGTAAATCAGAGATTTGGAAAATGCCTACTAGAGTTA
AGTGGAAATAATGCCATAATAGTGATGGATGATGCGGACATTGAACTTGCCGTTCGTTCTGTTTTATTTGCCGCTGTTGGTACAGCTGGT
CAXGCGCTGTACAACGTGCCGGAGACTGTTGTTCACGAGACAGTATATGAAAAAGTACTTGAACGACTAGTTGATGTGTATAAGCAAGTT
AAGATTGGGGATCCTTTGGAAAAAGGTACTTTGCTTGGGCCACTTCATACTCGTACTTCTAGGGAAAACTTCGACAAGGGAATCCAAAAT
ATCAAGTCCCAGGGAGGAAAGATCCTTACAGGTGGTTCAGTCATAGAATCTGAGGGTAACTTTGTGCAGCCAACAATAGTTGAAATTTCT
CCAAAGGCTGAAGTTGTGAAGGAAGAATTGTTTGCTCCAGTTCTTTATGTGATGAAGTTTAAGACTTTCAAAGAAGCAGTTGAAATTAAC
AACTCTGTCCCTCAAGGTTTAAGTAGTTCCATCTTCACTCGGAATCCTGAAGTCATATTTAAGTGGATTGGACCTCAAGGAAGTGATTGT
GGCATTGTTAATGTAAACATACCAACAAATGGAGCTGAAATTGGTGGTGCTTTTGGAGGTGAAAAAGCTACTGGTGGTGGCCGTGAGGCA
GGAAGCGATTCTTGGAAACAATATATGGGCGCTCAACTTGTACACTCAATTATGGGAATGAACTACCATTGGCACAGGGAATCAATTTTG
GCTAGTGAAATTGGTGCAGAACTTGXTCGTATAGTGCTCCGGCTGCCTCCATGGTTCAATACTCATCCTATAGTACTTGTAGTTGACCCA
GAAATCACTTGA\
Edits in Original Sequence 
(5')CAAGAAATCATTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTCAATGGATCCATTATCCCTTCTGAACGCCCTAACCA
TATGATGTTGGAGACGTGGAATCCTCTTGGGATAGTTGGTGTGATCACAGCTTTCAACTTCCCATGCGCTGTACTAGGATGGAATGCATG
CATTGCACTGGtCTGTGGCAATTGCGTTGTCTGGAAAGGXTGCTCCAACAACACCATTAGTTACCATAGCAATGACAAAGATCGTGGCTA
GAGTATTGGAGAAAAACGATTTACCTGGTTCAATTTTTACTGCCTTCTGTGGTGGTGCTGAAATTGGTGAAGCAATAGCAAAAGACACAA
GGATTCCTCTAGTCTCGTTCACTGGGAGCTCAAAGGTTGGTCTTGCAGTTCAGCAAACAGTAAATCAGAGATTTGGAAAATGCCTACTAG
AGTTAAGTGGAAATAATGCCATAATAGTGATGGATGATGCGGACATTGAACTTGCCGTTCGTTCTGTTTTATTTGCCGCTGTTGGTACAG
CTGGTCAXGCGCTGTACAACGTGCCGGAGACTGaTTGTTCACGAGACAGTATATGAAAAAGTACTTGAACGACTAGTTGATGTGTATAAG
CAAGTTAAGATTGGGGATCCTTTGGAAAAAGGTACTTTGCTTGGGCCACTTCATACTCGTACTTCTAGGGAAAACTTCGACAAGGGAATC
CAAAATATCAAGTCCCAGGGAGGAAAGATCCTTACAGGTGGTTCAGTCATAGAATCTGAGGGTAACTTTGTGCAGCCAACAATAGTTGAA
ATTTCTCCAAAGGCTGAAGTTGTGAAGGAAGAATTGTTTGCTCCAGTTCTTTATGTGATGAAGTTTAAGACTTTCAAAGAAGCAGTTGAA
ATTAACAACTCTGTCCCTCAAGGTTTAAGTAGTTCCATCTTCACTCGGAATCCTGAAGTCATATTTAAGTGGATTGGACCTCAAGGAAGT
GATTGTGGCATTGTTAATGTAAACATACCAACAAATGGAGCTGAAATTGGTGGTGCTTTTGGAGGTGAAAAAGCTACTGGTGGTGGCCGT
GAGGCAGGAAGCGATTCTTGGAAACAATATATGaGGCGCTCAACTTGTACACTCAATTATGGGAATGAACTACCATTGGCACAGGGAATC
AATTTTGGCTAGTGAAATTGGTGCAGAACTTGXTCGTATAGTGCTCCGGCTGCCTCCATGGTTCAATACTCATCCTATAGTACTTGTAGT
TGACCCAGAAATCACTTGA\(3')ATGTACCCTTCCTTGGAACTCAATAAAATGATATGTTATACATATTTGAAGAGTNGTTAACCTAAT
CTCATAACTCAAACGAAACACTTGCATTATTGGTGGCTATCAATCAATTACATAATATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan