ESTScan Details for Unigene SGN-U207981

Score 
706
Direction 
Forward
Predicted Peptide Sequence 
LGNHIYYKLKNTSKHSETLTFAKNMENFPIINLEKLNSAERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKCMEQRFK
ELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFAKRLEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFG
TKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKXERVATPX
Predicted Coding Sequence 
CTTGGTAATCACATATACTATAAGCTCAAAAACACATCTAAACACTCAGAAACACTTACTTTTGCAAAAAATATGGAGAACTTCCCAATT
ATCAACTTGGAAAAGCTCAATAGTGCTGAGAGAGATGCCACCATGGAAATGATTAAAGATGCCTGCGAAAACTGGGGCTTCTTTGAGTTG
GTGAACCATGGGATTCCACATGAAGTAATGGACACAGTGGAAAAATTGACAAAGGGACATTACAAGAAGTGCATGGAGCAGAGGTTTAAG
GAATTGGTGGCCAGCAAGGGTCTTGAAGCTGTGCAAGCTGAGGTTACTGATTTGGATTGGGAAAGCACTTTCTTCTTGCGCCATCTTCCT
GTTTCTAACATCTCTGAAGTACCCGATCTTGATGATGAATACAGAGAGGTCATGAGAGATTTTGCTAAAAGATTGGAGAAGTTAGCTGAG
GAGCTACTAGACTTGCTCTGTGAAAATCTTGGTCTTGAAAAGGGTTACTTGAAGAAGGCCTTTTATGGATCAAAAGGTCCTAACTTTGGA
ACTAAGGTGAGCAATTATCCCCCATGCCCCAAGCCAGATTTGATAAAGGGACTGCGCGCCCACACAGATGCTGGGGGCATTATACTTCTC
TTCCAAGACGACAAAGXTGAGCGGGTTGCAACTCCTCXX\
Edits in Original Sequence 
(5')CTTGGTAATCACATATACTATAAGCTCAAAAACACATCTAAACACTCAGAAACACTTACTTTTGCAAAAAATATGGAGAACTTCCC
AATTATCAACTTGGAAAAGCTCAATAGTGCTGAGAGAGATGCCACCATGGAAATGATTAAAGATGCCTGCGAAAACTGGGGCTTCTTTGA
GTTGGTGAACCATGGGATTCCACATGAAGTAATGGACACAGTGGAAAAATTGACAAAGGGACATTACAAGAAGTGCATGGAGCAGAGGTT
TAAGGAATTGGTGGCCAGCAAGGGTCTTGAAGCTGTGCAAGCTGAGGTTACTGATTTGGATTGGGAAAGCACTTTCTTCTTGCGCCATCT
TCCTGTTTCTAACATCTCTGAAGTACCCGATCTTGATGATGAATACAGAGAGGTCATGAGAGATTTTGCTAAAAGATTGGAGAAGTTAGC
TGAGGAGCTACTAGACTTGCTCTGTGAAAATCTTGGTCTTGAAAAGGGTTACTTGAAGAAGGCCTTTTATGGATCAAAAGGTCCTAACTT
TGGAACTAAGGTGAGCAATTATCCCCCATGCCCCAAGCCAGATTTGATAAAGGGACTGCGCGCCCACACAGATGCTGGGGGCATTATACT
TCTCTTCCAAGACGACAAAGXTGAGCGGGTTGCAACTCCTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan