ESTScan Details for Unigene SGN-U208057

Score 
459
Direction 
Reverse
Predicted Peptide Sequence 
MPVLPSFTKEQLQNVKVYRSNYQLDHFAHARDGTTIAQLRPPPMPPPPPKPPPPPPPRPPPPPTPPPAPNPPPAPP
Predicted Coding Sequence 
ATGCCAGTTTTACCAAGTTTCACAAAAGAACAACTACAGAATGTAAAAGTATATAGGAGTAATTATCAACTTGACCACTTTGCTCATGCA
AGAGATGGAACAACTATTGCTCAATTACGACCACCACCAATGCCTCCTCCACCACCAAAGCCACCGCCACCTCCACCTCCTAGACCACCA
CCTCCACCAACACCTCCGCCTGCTCCGAATCCTCCTCCAGCACCTCCA\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCACTGGGAATTAGCTACATCTTTTATTGATATGGTTTACTATTACAA
TACTAGTTCACAAGCTTCTTACATCCAAGATGTAAAGAAACTTGAAGGAACAAAACCACTTTAATGTGCTGGACAATATACGCAAACATT
TTTTTAAGT
(5')ATGCCAGTTTTACCAAGTTTCACAAAAGAACAACTACAGAATGTAAAAGTATATAGGAGTAATTATCAACTTGACCA
CTTTGCTCATGCAAGAGATGGAACAACTATTGCTCAATTACGACCACCACCAATGCCTCCTCCACCACCAAAGCCACCGCCACCTCCACC
TCCTAGACCACCACCTCCACCAACACCTCCGCCTGCTCCGAATCCTCCTCCAGCACCTCCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan