Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U208224

Score 
197
Direction 
Forward
Predicted Peptide Sequence 
YPFGYEEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMVQLLQLAVDCTAQYPDRRPSMAEVTSRIEELCRSSFMDSGGDIIDNG
EXAKGRFCSMNLNKKIVPSH
Predicted Coding Sequence 
TACCCATTCGGTTATGAAGAAGAAGGTGTCGACCTCCCAAGATGGGTGCAATCAGTGGTACGAGAGGAATGGACAGCTGAAGTATTTGAT
CTCGAGCTCCTTAGGTACCAAAACGTTGAGGAGGACATGGTCCAGCTTTTGCAACTCGCAGTTGACTGCACGGCTCAGTACCCGGACAGA
CGCCCTTCTATGGCTGAGGTCACTAGCCGCATTGAAGAACTTTGCCGGTCTAGTTTCATGGATTCAGGAGGTGACATAATTGACAATGGA
GAAGXTGCAAAGGGTAGATTCTGCAGCATGAATTTGAACAAGAAAATAGTTCCATCCCATTAA\
Edits in Original Sequence 
(5')TACCCATTCGGTTATGAAtGAAGAAGGTGTCGACCTCCCAAGATGGGTGCAATCAGTGGTACGAGAGGAATGGACAGCTGAAGTAT
TTGATCTCGAGCTCCTTAGGTACCAAAACGTTGAGGAGGACATGGTCCAGCTTTTGCAACTCGCAGTTGACTGCACGGCTCAGTACCCGG
ACAGACGCCCTTCTATGGCTGAGGTCACTAGCCGCATTGAAGAACTTTGCCGGTCTAGTTTCATGGATTCAGGAGGTGACATAATTGACA
ATGGAGAAGXTGCAAAGGGTAGATTCTGCAGCATGAATTTGAACAAGAAAATAGTTCCATCCCATTAA\(3')TTTTTCCTTTTGAAGTT
TTTGATTGAGCATTTTAATTTCTTTGTTCATTCTTGGAGATTCTTCAGTGAAGGTCAATTGTTTATTTCTTTCTTTTTTTCGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan