ESTScan Details for Unigene SGN-U208257

Score 
560
Direction 
Forward
Predicted Peptide Sequence 
KQSDRSNSFFFQRLISFFVREEIMSHYENQYSAGQALQTDEYGNPIRQTDEYGNPVHTTGGTMGDYGTTTGTGGYGTHGTTTGTGGYGTH
AAGIGAGTGTGTTGILGGEQRGHEHGTLGGMLHRSGSSSSSSSEDDGQGGRRKKKGIKDKIKEKLPGGHKGDQTHSTTTGTTTGYGTTTG
TTAGYGVEGHHEKKGIMDKIKEKLPGHHGPGHH
Predicted Coding Sequence 
AAACAATCAGACAGATCAAACTCATTTTTCTTTCAGCGTTTAATTTCTTTCTTTGTTCGTGAGGAAATTATGTCGCACTACGAAAACCAA
TATAGTGCAGGCCAGGCTCTGCAGACTGATGAGTATGGCAATCCCATTCGTCAAACTGACGAATATGGGAACCCTGTCCATACCACTGGA
GGTACCATGGGTGACTATGGAACGACTACCGGAACAGGTGGGTACGGAACTCATGGAACGACCACCGGGACAGGTGGCTATGGAACCCAT
GCAGCTGGCATTGGCGCTGGAACCGGAACAGGAACAACTGGCATACTTGGTGGGGAACAACGGGGACATGAGCACGGTACCCTCGGTGGC
ATGCTTCACCGTTCTGGCAGCTCTAGCTCCAGCTCTTCAGAGGATGATGGACAAGGCGGAAGGAGGAAGAAGAAAGGGATAAAGGATAAG
ATTAAGGAGAAATTGCCTGGAGGACACAAGGGCGATCAGACCCACTCAACTACAACCGGGACTACTACCGGTTATGGGACTACTACCGGG
ACTACTGCTGGTTATGGTGTCGAAGGGCATCATGAGAAGAAAGGAATCATGGATAAGATCAAGGAGAAACTTCCAGGCCACCATGGCCCT
GGCCACCACTAG\
Edits in Original Sequence 
(5')AAACAATCAGACAGATCAAACTCATTTTTCTTTCAGCGTTTAATTTCTTTCTTTGTTCGTGAGGAAATTATGTCGCACTACGAAAA
CCAATATAGTGCAGGCCAGGCTCTGCAGACTGATGAGTATGGCAATCCCATTCGTCAAACTGACGAATATGGGAACCCTGTCCATACCAC
TGGAGGTACCATGGGTGACTATGGAACGACTACCGGAACAGGTGGGTACGGAACTCATGGAACGACCACCGGGACAGGTGGCTATGGAAC
CCATGCAGCTGGCATTGGCGCTGGAACCGGAACAGGAACAACTGGCATACTTGGTGGGGAACAACGGGGACATGAGCACGGTACCCTCGG
TGGCATGCTTCACCGTTCTGGCAGCTCTAGCTCCAGCTCTTCAGAGGATGATGGACAAGGCGGAAGGAGGAAGAAGAAAGGGATAAAGGA
TAAGATTAAGGAGAAATTGCCTGGAGGACACAAGGGCGATCAGACCCACTCAACTACAACCGGGACTACTACCGGTTATGGGACTACTAC
CGGGACTACTGCTGGTTATGGTGTCGAAGGGCATCATGAGAAGAAAGGAATCATGGATAAGATCAAGGAGAAACTTCCAGGCCACCATGG
CCCTGGCCACCACTAG\(3')AATGCTGTTGCAAATAAATACAAATAATACATGTAATATGTTGGTCTAATACTTGTATCTTAAGGCGTT
GTTTCGAGTCGTTTTAGCGAGTCTTTGAGGCGTGGCGTCTATTTTAATAAAGCCATGCTAGCACTCTTTAAGTGCTTGTAGTAGCAGGTT
GTTATATGTGAGTCTCAGGACCTGTCCTCCGTCAAAAAAAAACCTCGTGCCGAATGGCACGAAGGCCAACTACTCAGAGACCAGGAATCA
GTAATATGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan