ESTScan Details for Unigene SGN-U208266

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
NDAHAPXDPSTARSPVDFRLSELIDKIHPMEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNVVCCTGID
KYRVHQFAASVRSCKPPEVYKGKGIMYIDEVIKKKQGKKSNENIGSWLFLGLSSLYYARQFCFRMLDSSSTIVVEGANFSMTLCXISYFI
LSTAIENDEGFDE
Predicted Coding Sequence 
XCAAATGATGCTCATGCTCCAXCTGACCCGTCAACTGCTAGATCTCCAGTGGACTTTAGATTAAGTGAGCTGATTGATAAAATTCATCCA
ATGGAAGCTAAGTTCTTTCGTTTTCTGAAGATTGTTGGAGTTGGTTTCAAGGCTCGAGCAGAATCCGAAGGCCGTCTCCTGTACCTTAAG
CTAGGTTACAGCCACGAGGTTGAACTGACTGTGCCTCCTGCCGTTCGTGTCTTCTGTTTCAAACCCAATGTGGTTTGCTGCACTGGGATT
GACAAGTACAGGGTACACCAGTTTGCTGCTTCTGTAAGGAGCTGTAAGCCGCCTGAAGTTTACAAAGGCAAAGGCATTATGTACATTGAT
GAAGTGATTAAAAAGAAGCAAGGAAAGAAATCAAATGAGAACATCGGTTCATGGTTATTTCTTGGACTTTCTTCCCTTTATTATGCTAGA
CAGTTTTGCTTTAGGATGCTAGACAGTTCCTCTACCATAGTCGTAGAAGGTGCTAACTTCTCAATGACTCTTTGTGXTATTAGCTATTTC
ATCCTTTCAACTGCTATAGAGAATGACGAAGGCTTTGATGAA\
Edits in Original Sequence 
(5')XCAAATGATGCTCATGCTCCAXCTGACCCGTCAACTGCTAGATCTCCAGTGGACTTTAGATTAAGTGAGCTGATTGATAAAATTCA
TCCAATGGAAGCTAAGTTCTTTCGTTTTCTGAAGATTGTTGGAGTTGGTTTCAAGGCTCGAGCAGAATCCGAAGGCCGTCTCCTGTACCT
TAAGCTAGGTTACAGCCACGAGGTTGAACTGACTGTGCCTCCTGCCGTTCGTGTCTTCTGTTTCAAACCCAATGTGGTTTGCTGCACTGG
GATTGACAAGTACAGGGTACACCAGTTTGCTGCTTCTGTAAGGAGCTGTAAGCCGCCTGAAGTTTACAAAGGCAAAGGCATTATGTACAT
TGATGAAGTGATTAAAAAGAAGCAAGGAAAGAAATCaAAATGAGAACATCGGTTCATGGTTATTTCTTGGACTTTCTTCCCTTTATTATG
CTAGACAGTTTTGCTTTAGGATGCTAGACAGTTCCTCTACCATAGTCGTAGAAGGTGCTAACTTCTCAATGACTCTTTGTGXTATTAGCT
ATTTCATCCTTTCAACTGCTATAGAGAAgTGACGAAGGCTTTGATGAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan