ESTScan Details for Unigene SGN-U208364

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
RDVCQQAERHWASKIIRGQAPKDEGSGGSLPPLQEYIDSARNRQRALLDVEIQNRSINPAAKKPQFDFDNIIFRIQSRKSEVLVENIHKS
GCEDHSKMGASVQNNIFVDQCR
Predicted Coding Sequence 
XXGAGGGATGTCTGTCAGCAAGCAGAGCGACATTGGGCATCAAAGATCATTCGAGGACAAGCTCCTAAAGATGAAGGTAGTGGTGGTTCT
CTTCCCCCTCTCCAAGAATACATTGATAGTGCTAGGAACAGGCAAAGAGCTCTGCTTGATGTTGAGATTCAGAACCGAAGCATCAATCCT
GCTGCAAAGAAGCCTCAGTTTGATTTTGATAATATCATATTCAGAATCCAATCTCGAAAGTCAGAAGTGCTTGTGGAAAACATTCACAAA
AGTGGCTGTGAAGACCATTCAAAGATGGGCGCAAGTGTACAAAACAACATTTTTGTGGATCAATGCCGTTAA\
Edits in Original Sequence 
(5')XXGAGGGATGTCTGTCAGCAAGCAGAGCGACATTGGGCATCAAAGATCATTCGAGGACAAGCTCCTAAAGATGAAGGTAGTGGTGG
TTCTCTTCCCCCTCTCCAAGAATACATTGATAGTGCTAGGAACAGGCAAAGAGCTCTGCTTGATGTTGAGATTCAGAACCGAAGCATCAA
TCCTGCTGCAAAGAAGCCTCAGTTTGATTTTGtATAATATCATATTCAGAATCCAATCTCGAAAGTCAGAAGTGCTTGTGGAAAACATTC
ACAAAAGTGGCTGTGAAGACCATTCAAAGATGGGCGCAAGTGTACAAAACAACATTTTTGTGGATCAATGCCGTTAA\(3')CTTCTTAT
AGATTCTCAAATCAGATAAGTGCAGTCAAATCCCAAGATTAGTGTTACCAAAAAATTCATTGCTCGAAGTATGCATAGCTTCTAAGCTCA
TATTCTTATGTCGCAGACTTTACATAGAAATTGTTTTCTCTTGTTATACATTTCTCTTGTTATGGAATTTATAAGTAGGATTGTTTCTCT
TGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan