ESTScan Details for Unigene SGN-U208383

Score 
677
Direction 
Forward
Predicted Peptide Sequence 
RPAAAEGARIAGASRIIGXDLNASRFELAKKFGVTEFVNPKDYNKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVG
VPHKEAVFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELELEKFITHQLPFSDINKAFDLMLKGEGLAASSIWSTKLV
Predicted Coding Sequence 
XGTAGGCCTGCTGCTGCAGAAGGAGCAAGGATAGCAGGGGCTTCAAGGATTATCGGTGXTGATTTGAATGCAAGCAGATTTGAGCTAGCA
AAGAAATTTGGCGTGACAGAATTTGTGAACCCGAAGGACTATAACAAACCAGTTCAAGAGGTTATTGCTGAGATGACTGATGGAGGAGTC
GACAGAAGCGTAGAGTGCACTGGCCACATTGATGCTATGATTTCTGCATTTGAATGTGTCCATGATGGCTGGGGAGTGGCTGTACTTGTG
GGAGTACCCCATAAAGAAGCTGTGTTTAAGACACATCCAATGAACTTGTTGAATGAAAGGACTCTCAAGGGCACTTTCTTTGGGAACTAC
AAGCCACGATCCGATCTCCCTTCTGTTGTGGAGAAATACATGAATAAGGAACTTGAATTGGAGAAGTTCATAACTCATCAACTCCCATTT
TCTGATATCAACAAGGCTTTTGATCTCATGCTGAAAGGAGAAGGTCTTGCTGCATCATCCATATGGAGCACTAAGCTTGTATAA\
Edits in Original Sequence 
(5')XGTAGGCCTGCTGCTGCAGAAGGAGCAAGGATAGCAGGGGCTTCAAGGATTATCGGTGXTGATTTGAATGCAAGCAGATTTGAGCT
AGCAAAGAAATTTGGCGTGACAGAATTTGTGAACCCGAAGGACTATAACAAACCAGTTCAAGAGGTTATTGCTGAGATGACTGATGGAGG
AGTCGACAGAAGCGTAGAGTGCACTGGCCACATTGATGCTATGATTTCTGCATTTGAATGTGTCCATGATGGCTGGGGAGTGGCTGTACT
TGTGGGAGTACCCCATAAAGAAGCTGTGTTTAAGACACATCCAATGAACTTGTTGAATGAAAGGACTCTCAAGGGCACTTTCTTTGGGAA
CTACAAGCCACGATCCGATCTCCCTTCTGTTGTGGAGAAATACATGAATAAGGAACTTGAATTGGAGAAGTTCATAACTCATCAACTCCC
ATTTTCTGATATCAACAAGGCTTTTGATCTCATGCTGAAAGGAGAAGGTCTTcGCTGCATCATCCATATGGAGCACTAAGCTTGTATAA\
(3')AAATTTTCCCAACAGTATCTTCCTTTGTTATGTTATTCCTTTGCAAAAGCCTATAAATAACTGGCGTTTCTGCTTTTCCTTCCAAA
AAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan