ESTScan Details for Unigene SGN-U208684

Score 
992
Direction 
Forward
Predicted Peptide Sequence 
MASTQCFLHHHALSSPARTSSQRYVTPLKPNQLVCRAQKQSSTQEDDANNNTVSRRLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPK
SNTDFLPYNGDGFKLQVPAKWNPSKEIEYPGQVLRFEDNFDSTSNLIVTVTPTDKKAITDYGSPEEFLSQVDYLLGKQAYFGKTDSEGGF
ESGAVATANLLEASSTNVGGKEX
Predicted Coding Sequence 
ATGGCTTCCACACAATGCTTCTTGCACCACCATGCACTCTCTAGCCCAGCTAGAACATCCTCACAAAGATATGTTACACCCCTCAAGCCT
AACCAATTGGTTTGCCGTGCCCAAAAACAGTCATCAACTCAAGAAGATGATGCCAACAACAACACAGTCTCTCGCCGATTGGCTCTCACT
GTCCTCATTGGTGCTGCTGCCATTGGTTCCAAGGTCTCCCCTGCCGATGCTGCTTATGGAGAAGCTGCAAACGTCTTTGGTAAGCCAAAG
TCAAACACAGATTTCTTGCCATACAACGGAGATGGATTCAAGCTACAAGTCCCAGCCAAATGGAACCCAAGCAAAGAAATTGAGTACCCT
GGTCAAGTTCTCAGATTTGAAGACAACTTCGATTCCACCAGCAACCTCATCGTTACTGTCACTCCAACTGACAAGAAAGCCATCACTGAC
TATGGCTCCCCCGAAGAGTTCCTCTCTCAAGTGGACTATCTGCTAGGAAAGCAAGCTTACTTTGGCAAAACTGATTCAGAGGGTGGATTT
GAATCTGGTGCAGTGGCAACTGCTAACTTATTGGAGGCATCAAGCACAAATGTGGGAGGAAAAGAGTXX\
Edits in Original Sequence 
AAGAAACAAAGCTAAGGCTTAATTGTTATTGAGAGCAGTGAGCA(5')ATGGCTTCCACACAATGCTTCTTGCACCACCATGCACTCTCT
AGCCCAGCTAGAACATCCTCACAAAGATATGTTACACCCCTCAAGCCTAACCAATTGGTTTGCCGTGCCCAAAAACAGTCATCAACTCAA
GAAGATGATGCCAACAACAACACAGTCTCTCGCCGATTGGCTCTCACTGTCCTCATTGGTGCTGCTGCCATTGGTTCCAAGGTCTCCCCT
GCCGATGCTGCTTATGGAGAAGCTGCAAACGTCTTTGGTAAGCCAAAGTCAAACACAGATTTCTTGCCATACAACGGAGATGGATTCAAG
CTACAAGTCCCAGCCAAATGGAACCCAAGCAAAGAAATTGAGTACCCTGGTCAAGTTCTCAGATTTGAAGACAACTTCGATTCCACCAGC
AACCTCATCGTTACTGTCACTCCAACTGACAAGAAAGCCATCACTGACTATGGCTCCCCCGAAGAGTTCCTCTCTCAAGTGGACTATCTG
CTAGGAAAGCAAGCTTACTTTGGCAAAACTGATTCAGAGGGTGGATTTGAATCTGGTGCAGTGGCAACTGCTAACTTATTGGAGGCATCA
AGCACAAATGTGGGAGGAAAAGAGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan