Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U208692

Score 
404
Direction 
Forward
Predicted Peptide Sequence 
YPLKKDHGAPTDEARHAGDLGNIVAGPDGVAEISISDMQIPLSGVHSILGRAVVVHADPDDLGRGGHELSKTTGNAGARVGCGVIGLQSS
XLVFVLLNHAIPXLRTLCSYTQLSDIPFPIPPKSW
Predicted Coding Sequence 
TATCCACTTAAGAAAGATCATGGAGCTCCTACTGATGAAGCACGTCATGCGGGTGATTTAGGCAACATTGTTGCTGGTCCTGATGGAGTG
GCCGAGATATCAATTTCGGATATGCAGATCCCTCTTTCTGGGGTACACTCTATCTTGGGGAGAGCTGTAGTTGTGCATGCTGATCCTGAT
GATCTTGGACGAGGTGGACATGAACTTAGTAAGACAACTGGAAATGCTGGTGCAAGAGTTGGTTGTGGCGTTATTGGGCTTCAATCATCT
GXTTTAGTATTTGTGTTGCTCAATCATGCTATTCCTGXTCTGAGAACACTTTGTAGCTATACTCAACTTTCAGACATCCCTTTCCCAATA
CCCCCAAAGAGTTGG\
Edits in Original Sequence 
(5')TATCCACTTAAGAAAGATCATGGAGCTCCTACTGATGAAGCACGTCATGCGGGTGATTTAGGCAACATTGTTGCTGGTCCTGATGG
AGTGGCCGAGATATCAATTTCGGATATGCAGATCCCTCTTTCTGGGGTACACTCTATCTTGGGGAGAGCTGTAGTTGTGCATGCTGATCC
TGATGATCTTGGACGAGGTGGACATGAACTTAGTAAGACAACTGGAAATGCTGGTGCAAGAGTTGGTTGTGGCGTTATTGGGCTTCAATC
ATCTGXTTTAGTATTTGTGTTGCTCAATCATGCTATTCCTGXTCTGAGAACACTTTGTAGCTATACTCAACTTTCAGACATCCCTTTCCC
AATACCCCCAAAGAGTTGG\(3')TTAATAAAACATCAGTTATTTACTCTCAAGTCTACTGTTTGAAACTCTGTTTGCGGTGCAGATCAA
TTCTGTATCATTGTGATTCAGCAGCAAAATGACTTTACCGTTACTTTTTATTGATTGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan