ESTScan Details for Unigene SGN-U208695

Score 
640
Direction 
Forward
Predicted Peptide Sequence 
TTGLIVKEEEVVTIKVKPGWKRGTKITFESKGDERPGTLAADIIFSIDEKTHPLFKRQGDDLVLGVEVPLVQALTGCTITVPLLGGEEMT
MSFDDEIIYPGYEKIIAGQGMPKPKEEGRRGDLVLQFLVNFPLDLSEEQKSEVVSILEEDFS
Predicted Coding Sequence 
XCAACCACAGGGCTAATTGTTAAAGAAGAAGAAGTTGTAACAATAAAAGTGAAGCCGGGATGGAAGAGAGGAACAAAAATTACATTTGAA
AGTAAAGGGGATGAGAGACCAGGCACACTTGCAGCTGATATAATATTCTCAATTGATGAGAAAACACATCCATTGTTCAAGAGACAAGGA
GATGACTTGGTTCTTGGTGTTGAAGTCCCTCTAGTCCAAGCTCTCACAGGATGTACAATTACTGTACCTCTTTTAGGTGGTGAAGAAATG
ACTATGTCATTTGATGATGAAATTATTTATCCAGGATATGAGAAAATCATAGCAGGACAAGGCATGCCTAAACCTAAAGAGGAAGGTAGG
AGAGGAGACCTTGTGCTACAATTTCTTGTCAATTTTCCTTTAGATTTGAGTGAGGAACAAAAGTCTGAGGTTGTTAGCATACTAGAAGAA
GATTTCTCTTGA\
Edits in Original Sequence 
(5')XCAACCACAGGGCTAATTGTTAAAGAAGAAGAAGTTGTAACAATAAAAGTGAAGCCGGGATGGAAGAGAGGAACAAAAATTACATT
TGAAAGTAAAGGGGATGAGAGACCAGGCACACTTGCAGCTGATATAATATTCTCAATTGATGAGAAAACACATCCATTGTTCAAGAGACA
AGGAGATGACTTGGTTCTTGGTGTTGAAGTCCCTCTAGTCCAAGCTCTCACAGGATGTACAATTACTGTACCTCTTTTAGGTGGTGAAGA
AATGACTATGTCATTTGATGATGAAATTATTTATCCAGGATATGAGAAAATCATAGCAGGACAAGGCATGCCTAAACCTAAAGAGGAAGG
TAGGAGAGGAGACCTTGTGCTACAATTTCTTGTCAATTTTCCTTTAGATTTGAGTGAGGAACAAAAGTCTGAGGTTGTTAGCATACTAGA
AGAAGATTTCTCTTGA\(3')TGTAATTAAAGATGGTACATAGTCGTTGTGCTACAATTTCTTGTCAAATTTCGCTTAGATTTGTGAGGA
ACAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan