ESTScan Details for Unigene SGN-U208731

Score 
209
Direction 
Forward
Predicted Peptide Sequence 
EXDKESKQHALWSSSGVFTKNIDSANTLVRGLRAGTVWVNCYDVFDAAIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI
Predicted Coding Sequence 
XGTGAAGXTGATAAAGAGAGCAAACAACACGCGCTATGGTCTAGCAGCGGAGTTTTCACAAAGAACATCGACTCAGCAAACACGTTGGTT
CGGGGACTAAGAGCTGGAACTGTGTGGGTTAACTGCTATGATGTCTTTGATGCTGCAATTCCTTTTGGAGGATACAAGATGAGTGGCATG
GGCAGAGAAAAGGGTATTTACAGTCTTAGCAACTACTTACAAGTGAAGGCTGTTGTTACTCCATTGAAGAATCCTGCATGGATATAG\
Edits in Original Sequence 
(5')XGTGAAGXTGATAAAGAGAGCAAACAACACGCGCTATGGTCTAGCAGCgGGAGTTTTCACAAAGAACATCGACTCAGCAAACACGT
TGGTTCGGGGACTAAGAGCTGGAACTGTGTGGGTTAACTGCTATGATGTCTTTGATGCTGCAATTCCTTTTGGAGGATACAAGATGAGTG
GCATGGGCAGAGAAAAGGGTATTTACAGTCTTAGCAACTACTTACAAGTGAAGGCTGTTGTTACTCCATTGAAGAATCCTGCATGGATAT
AG\(3')ATCACTACACTGGTCACCCACTCACCCTGCTTATAATCAAAATAATCTTCCCCTGTAAAATGGAGCACATGTTTGTTTACATG
ACATTGTTGTCTCTTTTTTCTCTTCTTTTTGTTATGCTATTATTCATAGTAACTAATATGCATCAATACAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan