ESTScan Details for Unigene SGN-U208776

Score 
622
Direction 
Forward
Predicted Peptide Sequence 
MVSSNGEGSSKGGVIRECRICQEEDDENDMESPCACNGTLKFAHGNVFRDGAIKKVTSPVKSXNKVFSPNYTLPPARSNPDVMAIDIRQA
WGPGMDIRNPHFLAFAAAERQFLQSEYDDYAIASSGESSMFPLCCNYFDATLADTPNLDGHTGLRDGAGLIDILQFSDFTASAGSFSPPL
LCNGPDMVHDTMPKEEAGLRTPWSVA
Predicted Coding Sequence 
ATGGTTAGTAGTAATGGAGAAGGTAGTTCAAAGGGTGGTGTTATTAGAGAGTGTAGGATTTGTCAAGAAGAAGATGATGAAAATGACATG
GAATCTCCTTGTGCTTGCAATGGCACTCTCAAGTTTGCTCATGGAAATGTATTCAGAGATGGTGCAATAAAAAAGGTGACATCACCTGTG
AAATCTGXTAATAAGGTCTTTTCACCAAACTATACCCTTCCACCTGCAAGGAGCAACCCTGATGTAATGGCAATTGATATCAGGCAAGCA
TGGGGACCAGGCATGGATATTAGGAATCCTCATTTTCTGGCTTTTGCTGCTGCTGAGCGTCAATTCCTGCAGTCAGAGTATGATGACTAT
GCCATTGCTAGCAGTGGXGAGTCTAGCATGTTTCCGCTATGTTGCAATTATTTTGATGCTACTCTTGCTGATACGCCAAACCTTGATGGT
CATACGGGACTTCGCGATGGTGCAGGACTCATCGACATTCTTCAATTTTCAGATTTCACTGCTTCAGCTGGCAGCTTTTCTCCTCCCTTG
TTATGTAATGGNCCGGACATGGTACATGATACAATGCCGAAGGAGGAGGCAGGGTTAAGGACGCCATGGTCGGTAGCX\
Edits in Original Sequence 
AAAAAAATGGTGGATGAGTTTATGGTATGTGTAGATAGGATGATAATAGCAACAACATGTTATGGTGAAGACTCATCACTTAATAATAAT
AATACTCTATTGACTACTAGTTCTACTACTCATAATGATGAAAAAAACAATTCAAATGAAGAA
(5')ATGGTTAGTAGTAATGGAGAAGG
TAGTTCAAAGGGTGGTGTTATTAGAGAGTGTAGGATTTGTCAAGAAGAAGATGATGAAAATGACATGGAATCTCCTTGTGCTTGCAATGG
CACTCTCAAGTTTGCTCATaGGAAATGTATTCAGAGATGGTGCAATAAAAAAGGTGACATCACCTGTGAAATCTGXTAATAAGGTCTTTT
CACCAAACTATACCCTTCCACCTGCAAGGAGCAACCCTGATGTAATGGCAATTGATATCAGGCAAGCATGGGGACCAGGCATGGATATTA
GGAATCCTCATTTTCTGGCTTTTGCTGCTGCTGAGCGTCAATTCCTGCAGTCAGAGTATGATGACTATGCCATTGCTAGCAGTGGXGAGT
CTAGCATGTTTCCGCTATGTTGCAATTATTTTGATGCTACTCTTGCTGATACGCCAAACCTTGATGGTCATACGGGACTTCGCGATGGTG
CAGGACTCATCGACATTCTTCAATTTTCAGATTTCACTGCTTCAGCTGGCAGCTTTTCTCCTCCCTTGTTATGTAATGGNCCGGACATGG
TACATGATACAATGCCGAAGGAGGAGGCAGGGTTAAGGACGCCATGGTCGGTAGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan