ESTScan Details for Unigene SGN-U208791

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
HITISLTRKAXKSRQNCNSDMASNGISHANGTLGKVITCRAAVAYGPGQPLVIEQVQVDPPQEMEVRVKILFSSICHTDLSFWKGENEAQ
RAFPRILGHEASGVVESVGEGVTDMKPGDYEYQYSMENVETAFTANLLKGLTCVASSGVNPFKSVMANDGKCRFRNKDGNPIYHFLNTST
FSEYTVVDSACLVKIDPHAPLDKMTLLSCGVATGLGAAGTX
Predicted Coding Sequence 
CACATAACTATTAGCCTGACTAGGAAAGCCCXGAAATCCAGACAGAATTGTAACAGCGACATGGCTTCTAACGGCATTTCCCATGCTAAT
GGTACACTTGGAAAGGTTATCACTTGCAGAGCTGCTGTGGCTTATGGTCCAGGGCAGCCTTTGGTCATAGAACAAGTGCAGGTTGATCCA
CCTCAGGAAATGGAGGTCCGAGTTAAGATCCTCTTTAGTTCCATCTGCCATACCGATCTCAGTTTTTGGAAAGGCGAGAACGAAGCTCAA
CGAGCTTTCCCTCGAATTCTCGGACATGAAGCCTCCGGAGTGGTGGAGAGCGTGGGAGAAGGGGTGACAGACATGAAACCGGGAGACTAT
GAGTACCAATATTCAATGGAGAATGTGGAGACTGCGTTTACTGCAAATCTTCTAAAGGGACTAACTTGTGTGGCAAGTTCAGGXGTGAAT
CCATTCAAAAGTGTGATGGCCAACGATGGCAAGTGCAGGTTCAGGAACAAGGATGGTAACCCCATATATCACTTCCTCAACACATCCACA
TTCAGCGAGTATACTGTTGTTGATTCTGCCTGTTTAGTCAAGATTGACCCTCATGCCCCACTTGACAAGATGACCTTGCTTAGCTGCGGT
GTTGCTACTGGTCTGGGAGCTGCTGGAACACXX\
Edits in Original Sequence 
(5')CACATAACTATTAGCCTGACTAGGAAAGCCCXGAAATCCAGACAGAATTGTAACAGCGACATGGCTTCTAACGGCATTTCCCATGC
TAATGGTACACTTGGAAAGGTTATCACTTGCAGAGCTGCTGTGGCTTATGGTCCAGGGCAGCCTTTGGTCATAGAACAAGTGCAGGTTGA
TCCACCTCAGGAAATGGAGGTCCGAGTTAAGATCCTCTTTAGTTCCATCTGCCATACCGATCTCAGTTTTTGGAAAGGCGAGAACGAAGC
TCAACGAGCTTTCCCTCGAATTCTCGGACATGAAGCCTCCGGAGTGGTGGAGAGCGTGGGAGAAGGGGTGACAGACATGAAACCGGGAGA
CTATGtAGTACCAATATTCAATGGAGAATGTGGAGACTGCGTTTACTGCAAATCTTCTAAAGGGACTAACTTGTGTGGCAAGTTCAGGXG
TGAATCCATTCAAAAGTGTGATGGCCAACGATGGCAAGTGCAGGTTCAGGAACAAGGATGGTAACCCCATATATCACTTCCTCAACACAT
CCACATTCAGCGAGTATACTGTTGTTGATTCTGCCTGTTTAGTCAAGATTGACCCTCATGCCCCACTTGACAAGATGACCTTGCTTAGCT
GCGGTGTTGCTACTGGTCTGGGAGCTGCgTGGAACACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan