ESTScan Details for Unigene SGN-U208850

Score 
292
Direction 
Forward
Predicted Peptide Sequence 
VQTTRPVKSVGAMYSAVMFLGGTNTSAVQSVVAVERTVFYREKAAGMYSALPYAFSQVAIETIYVAIQTFIYSVILYAMIGFQWTAGKFF
LFYFFVFMCFVYFTMYGMMLVALTPNYHIAAIXHVFLPQLLEPVHRFPHSKNTKFRYGGGGITGLLQCLGQYWACNRLKRREEX
Predicted Coding Sequence 
XGTGTCCAAACAACAAGACCTGTTAAATCTGTTGGAGCTATGTATTCTGCTGTTATGTTCCTTGGTGGAACTAATACTTCAGCCGTGCAG
TCTGTTGTTGCTGTAGAAAGGACAGTCTTTTATCGAGAAAAAGCAGCAGGAATGTATTCTGCACTCCCTTATGCATTCTCTCAGGTGGCC
ATAGAGACTATCTATGTTGCAATTCAAACTTTTATTTACAGTGTTATTCTGTATGCGATGATTGGATTCCAGTGGACAGCTGGAAAGTTC
TTTTTGTTCTACTTCTTTGTGTTCATGTGTTTCGTCTATTTCACGATGTATGGAATGATGCTTGTTGCACTCACTCCAAACTACCACATT
GCGGCCATTGXTCATGTCTTTCTTCCTCAGCTTTTGGAACCTGTTCACCGGTTTCCTCATTCCAAGAACACGAAATTCCGATATGGTGGA
GGTGGTATTACTGGGCTTCTCCAGTGTCTCGGACAATATTGGGCTTGTAACCGTCTCAAGAGGCGAGAAGAACAX\
Edits in Original Sequence 
(5')XGTGTCCAAACAACAAGACCTGTTAAATCTaGTTGGAGCTATGTATTCTGCTGTTATGTTCCTTGGTGGAACTAATACTTCAGCCG
TGCAGTCTGTTGTTGCTGTAGAAAGGACAGTCTTTTATCGAGAAAAAGCAGCAGGAATGTATTCTGCACTCCCTTATGCATTCTCTCAGG
TGGCCATAGAGACTATCTATGTTGCAATTCAAACTTTTATTTACAGTGTTATTCTGTATGCGATGATTGGATTCCAGTGGACAGCTGGAA
AGTTCTTTTTGTTCTACTTCTTTGTGTTCATGTGTTTCGTCTATTTCACGATGTATGGAATGATGCTTGTTGCACTCACTCCAAACTACC
ACATTGCGGCCATTGXTCATGTCTTTCTTCCTCAGCTTTTGGAACCTGTTCACCGGTTTCCTCATTCCAAGAACACGAAATTCCGATATG
GTGGAGGTGGTATTACTGGGCTTCTCCAGTGTCTCGGACAATATaTGGGCTTGTAACCGTCTCAAGtAGGCGAGAAGAACAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan