ESTScan Details for Unigene SGN-U208964

Score 
492
Direction 
Forward
Predicted Peptide Sequence 
MTSDSKVYNFRVVGEHNTKNDCWIIISGKVYDVTTFLDDHPGGDDVLLTATGKDATDDFEDVGHSDDAREMLKKYYIGELDSSTIPVEPK
YTPPPTPPSAGNQGSGSLTKILQFLLPLLILGVAYALRSLYHKEXDQTVMFQAADDKQMEYTIQPPSHVLLVISCNXVLVLKIRAFIQFI
CTFVGCPYGERYNNVATL
Predicted Coding Sequence 
ATGACTTCAGATTCCAAAGTTTATAACTTTAGAGTGGTGGGAGAGCACAACACCAAAAATGATTGCTGGATTATCATTTCTGGAAAGGTT
TATGACGTCACTACTTTTCTGGATGATCATCCTGGAGGTGATGATGTCTTGCTAACTGCAACAGGGAAGGATGCAACAGATGATTTTGAA
GATGTTGGTCACAGTGATGATGCAAGAGAGATGCTGAAGAAATACTACATTGGTGAGCTTGACAGTTCCACCATTCCTGTGGAACCCAAA
TATACTCCGCCTCCAACGCCACCATCCGCTGGAAACCAGGGTTCTGGAAGTTTAACAAAGATATTGCAATTCTTGTTACCTTTGTTGATA
TTGGGTGTAGCATACGCCTTGCGTTCCCTTTACCATAAAGAAXTAGATCAGACTGTCATGTTTCAAGCTGCXGATGACAAGCAGATGGAA
TACACAATACAACCACCTTCTCATGTGCTGCTTGTCATTTCCTGTAATGXTGTTTTAGTCTTGAAGATTCGTGCCTTTATTCAGTTTATT
TGTACCTTTGTCGGATGTCCCTACGGAGAGAGATATAACAATGTTGCTACTCTX\
Edits in Original Sequence 
CACACACCATACCCATAATACAGAAATTAAAAGTAGTTGGCGGAAGTTCAGAGGCAAAGTTATAAGTTTCTGCACTCTGATCGTATCCGG
TGATTGGTAAAAG
(5')ATGACTTCAGATTCCAAAGTTTATAACTTTAGAGTGGTGGGAGAGCACAACACCAAAAATGATTGCTGGATTA
TCATTTCTGGAAAGGTTTATGACGTCACTACTTTTCTGGATGATCATCCTGGAGGTGATGATGTCTTGCTAACTGCAACAGGGAAGGATG
CAACAGATGATTTTGAAGATGTTGGTCACAGTGATGATGCAAGAGAGATGCTGAAGAAATACTACATTGGTGAGCTTGACAGTTCCACCA
TTCCTGTGGAACCCAAATATACTCCGCCTCCAACGCCACCATCCGCTGGAAACCAGGGTTCTGGAAGTTTAACAAAGATATTGCAATTCT
TGTTACCTTTGTTGATATTGGGTGTAGCATACGCCTTGCGTTCCCTTTACCATAAAGAAXTAGATCAGACTGTCATGTTTCAAGCTGCXG
ATGACAAGCAGATGGAATACACAATACAACCACCTTCTCATGTGCTGCTTGTCATTTCCTGTAATGXTGTTTTAGTCTTGAAGATTCGTG
CgCTTTATTCAGTTTATTTGTACCTTTGTCGGATGTCCCTACGGAGAGAGATATAACAATGTTGCTACTCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan