ESTScan Details for Unigene SGN-U209127

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
RNPKVFFDMTIGGTPAGACGDGTVANTTPKTAENFRALCTGEKGLGKMGKPLHYKGSPFHRVVPGFMCQGGDITAGNGTGGESIFGGRFA
DENFMKKHTGPGIVSMANSGPCTNGSQFIISTIRTEWLDGKHVVVGQVVEGLDVIKKIEAVGTRSGGALILVIADCGXTFLDADLVFK
Predicted Coding Sequence 
XXGCGAAATCCAAAGGTTTTCTTTGACATGACCATCGGCGGCACACCAGCCGGXGCGTGTGGTGATGGAACTGTAGCCAACACCACTCCC
AAAACTGCCGAGAACTTCCGTGCACTTTGCACCGGCGAAAAAGGTCTGGGTAAAATGGGAAAGCCTTTACACTACAAAGGCTCACCATTC
CACCGTGTGGTTCCAGGTTTCATGTGTCAAGGCGGTGATATTACTGCCGGAAACGGTACCGGAGGTGAATCAATTTTCGGTGGTAGGTTT
GCTGATGAGAACTTTATGAAGAAGCATACTGGTCCTGGTATTGTATCTATGGCTAATTCTGGACCTTGTACTAATGGGTCCCAGTTTATT
ATCTCTACTATTAGAACTGAATGGCTCGATGGTAAACACGTGGTGGTTGGTCAAGTTGTTGAAGGTCTTGATGTTATTAAGAAGATCGAA
GCCGTTGGAACTCGATCTGGAGGTGCTCTAATCCTTGTTATTGCTGACTGTGGTXCAACTTTCCTAGATGCTGATCTAGTTTTTAAGTAA
\
Edits in Original Sequence 
(5')XXGCGAAATCCAAAGGTTTTCTTTGACATGACCATCGGCGGCACACCAGCCGGXGCGTGTGGTGATGGAACTGTAcGCCAACACCA
CTCCCAAAACTGCCGAGAACTTCCGTGCACTTTGCACCGGCGAAAAAGGTCTGGGTAAAATGGGAAAGCCTTTACACTACAAAGGCTCAC
CATTCCACCGTGTGGTTCCAGGTTTCATGTGTCAAGGCGGTGATATTACTGCCGGAAACGGTACCGGAGGTGAATCAATTTTCGGTGGTA
GGTTTGCTGATGAGAACTTTATGAAGAAGCATACTGGTCCTGGTATTGTATCTATGGCTAATTCTGGACCTTGTACTAATGGGTCCCAGT
TTATTATCTCTACTATTAGAACTGAATGGCTCGATGGTAAACACGTGGTGGTTGGTCAAGTTGTTGAAGGTCTTGATGTTATTAAGAAGA
TCGAAGCCGTTGGAACTCGATCTGGAcGGTGCTCTAATCCTTGTTATTGCTGACTGTGGTXCAACTTTCCTAGATGCTGATCTAGTTTTT
AAGTAA\(3')TTATCTTATTATGAGTGTCTTTTATATTTAAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan