Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U209159

Score 
51
Direction 
Forward
Predicted Peptide Sequence 
FATRTLQVEGKTVKAQIWDTAGQERHRAITSAYYRGAVGAGGVYDIPQRQTFDKSRGGFGNCEXHADSNIVIILAGN
Predicted Coding Sequence 
XXGTTCGCCACTCGAACTCTTCAGGTCGAGGGAAAAACAGTGAAGGCCCAGATATGGGACACTGCTGGACAAGAAAGGCACCGAGCCATT
ACCAGTGCTTACTATCGCGGAGCAGTTGGGGCGGGGGGTGTGTATGACATACCACAGAGGCAAACATTTGACAAGTCCAGAGGTGGCTTC
GGGAATTGTGAGXACCATGCAGACTCTAATATTGTAATCATACTGGCTGGAAAC\
Edits in Original Sequence 
(5')XXGTTCGCCACTCGAACTCTTCAGGTCGAGGGAAAAACAGTGAAGGCCCAGATATGGGACACTGCTGGACAAGAAAGGCACCGAGC
CATTACCAGTGCTTACTATCGCGGAGCAGTTGGGGCGGGGGGTGTGTATGACATACCACAGAGGCAAACATTTGACAAtGTCCAGAGGTG
GCTTCGGGAATTGTGAGXACCATGCAGACTCTAATATTGTAATCATACTGGCTGGAAAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan