ESTScan Details for Unigene SGN-U209242

Score 
184
Direction 
Forward
Predicted Peptide Sequence 
MACKHPPXMIIFEPVLGDFGLAKLVDTKLTQLPLKFCGTMGHIAPEYLSTGKSS
Predicted Coding Sequence 
ATGGCATGCAAACATCCTCCTAXGATGATAATTTTTGAACCTGTTCTTGGAGATTTTGGACTAGCAAAATTAGTTGATACAAAACTGACT
CAATTACCACTCAAGTTCTGTGGAACAATGGGCCACATTGCCCCAGAATACTTGTCTACTGGAAAATCATCT\
Edits in Original Sequence 
GCATTGTGATCCTAAGATCATTCATCTGATGATCTAA(5')ATGGCATGCAAACATCCTCCTAXGATGATAATTTTTGAACCTGTTCTTG
GAGATTTTGGACTAGCAAAATTAGTTGATACAAAACTGACTCAtATTACCACTCAAGTTCTGTGGAACAATGGGCCACATTGCCCCAGAA
TACTTGTCTACTGGAAAATCATCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan