ESTScan Details for Unigene SGN-U209286

Score 
572
Direction 
Forward
Predicted Peptide Sequence 
MGNCLGSSAKVDATLTSQTISASGASRNPSKTSNSSVPSSLSIPSYSRKSSVDSLSTPRSEGEILFSPNVKSFSFNELKSATRNFRPDSL
LGEGGFGYVFKGWIDENTLTAAKPGSGMVIAVKKLKPEGFQAHKEWVTEVNYLGQLRHPNLVKL
Predicted Coding Sequence 
ATGGGAAATTGCTTAGGTTCGTCAGCAAAAGTTGATGCCACTCTCACTTCTCAAACCATTTCTGCTTCTGGAGCTTCTAGGAATCCAAGC
AAAACCAGCAATTCTTCTGTTCCATCGAGTCTAAGTATTCCATCTTATAGTCGGAAAAGCAGTGTTGATAGCCTTTCTACTCCAAGATCT
GAAGGCGAAATTTTATTTTCCCCTAATGTTAAGTCCTTCTCATTTAATGAATTGAAAAGTGCAACAAGGAACTTTAGACCTGACAGTCTT
CTTGGTGAAGGAGGATTTGGTTATGTTTTCAAAGGATGGATTGATGAAAATACTCTTACTGCTGCAAAGCCTGGTTCTGGAATGGTCATT
GCAGTCAAAAAGTTGAAGCCAGAGGGTTTTCAGGCTCACAAGGAGTGGGTGACTGAAGTTAATTACCTCGGGCAACTTCGTCATCCAAAT
CTGGTTAAGCTC\
Edits in Original Sequence 
CCTTTATATAGAAAAAAAAAACCACACATTTATCACTACTTTTTTCATTTACAAGCTATAAGTATCACCCCTTATCATTTTCTCCACTGA
AACATAGGCACTCTGAAAATTTAAGGAAAGATTCTTTTTCAAAGACTTGTTTGTGGTGTCCAGTTTTTAGTTGTGTG
(5')ATGGGAAAT
TGCTTAGGTTCGTCAGCAAAAGTTGATGCCACTCTCACTTCTCAAACCATTTCTGCTTCTGGAGCTTCTAGGAATCCAAGCAAAACCAGC
AATTCTTCTGTTCCATCGAGTCTAAGTATTCCATCTTATAGTCGGAAAAGCAGTGTTGATAGCCTTTCTACTCCAAGATCTGAAGGCGAA
ATTTTATTTTCCCCTAATGTTAAGTCCTTCTCATTTAATGAATTGAAAAGTGCAACAAGGAACTTTAGACCTGACAGTCTTCTTGGTGAA
GGAGGATTTGGTTATGTTTTCAAAGGATGGATTGATGAAAATACTCTTACTGCTGCAAAGCCTGGTTCTGGAATGGTCATTGCAGTCAAA
AAGTTGAAGCCAGAGGGTTTTCAGGCTCACAAGGAGTGGGTGACTGAAGTTAATTACCTCGGGCAACTTCGTCATCCAAATCTGGTTAAG
CTC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan