ESTScan Details for Unigene SGN-U209346

Score 
551
Direction 
Forward
Predicted Peptide Sequence 
VSRADGSAAFEMGNTKVIAAVYGPREVQNKSQQINDKALVRCEYSMANFSTGIAGEKQRVTGDPQDIPCDSPDNGSLHIDTPNASSQIDI
FVQVLQADGGTRSACINAATLALADAGIPMRDLVTSCSAGYLNSTPLLDLNYLEDSAGGADVTVGFLPKLDKVTLLQMDAKLPMDTSDIV
MQLAX
Predicted Coding Sequence 
GTTTCCAGAGCTGATGGTTCTGCTGCTTTTGAAATGGGTAATACCAAAGTAATTGCTGCAGTTTATGGACCTAGGGAGGTTCAGAATAAG
AGCCAACAGATCAACGACAAGGCGCTGGTACGATGCGAGTATAGCATGGCTAATTTCAGCACTGGGATCGCCGGAGAAAAACAAAGGGTG
ACAGGAGATCCACAAGATATCCCTTGTGATTCGCCAGACAATGGAAGCTTGCATATTGACACACCTAATGCCTCCTCTCAGATAGACATT
TTTGTCCAAGTTCTCCAAGCAGATGGAGGTACAAGATCAGCATGTATAAATGCTGCAACGCTGGCGCTAGCTGATGCTGGAATTCCCATG
CGTGATCTTGTCACATCATGCAGTGCTGGATATCTGAACAGCACGCCCCTTCTTGATCTAAATTACTTGGAAGACAGTGCTGGTGGTGCT
GATGTCACTGTGGGATTTTTGCCTAAATTGGACAAAGTGACCCTTCTGCAGATGGATGCTAAATTACCAATGGATACTTCTGACATTGTC
ATGCAATTAGCAGXX\
Edits in Original Sequence 
(5')GTTTCCAGAGCTGATGGTTCTGCTGCTTTTGAAATGGGTAATACCAAAGTAATTGCTGCAGTTTATGGACCTAGGGAGGTTCAGAA
TAAGAGCCAACAGATCAACGACAAGGCGCTGGTACGATGCGAGTATAGCATGGCTAATTTCAGCACTGGcGATCGCCGGAGAAAAACAAA
GGGTGACAGGAGATCCACAgAGATATCCCTTGTGATTCGCCAGACAATGGAAGCTTGCATATTGACACACCTAATGCCTCgCTCTCAGAT
AGACATTTTTGTCCAAGTTCTCCAAGCAGATGGAGGTACAAGATCAGCATGTATAAATGCTGCAACGCTGGCGCTAGCTGATGCTGGAAT
TCCCATGCGTGATCTTGTCACATCATGCAGTGCTGGATATCTGAACAGCACGCCCCTTCTTGATCTAAATTACTTGGAAGACAGTGCTGG
TGGTGCTGATGTCACTGTGGGATTTTTGCCTAAATTGGACAAAGTGACCCTTCTGCAGATGGATGCTAAATTACCAATGGATACTTCTGA
CATTGTCATGCAATTAGCAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan