ESTScan Details for Unigene SGN-U209352

Score 
231
Direction 
Forward
Predicted Peptide Sequence 
EIENHFKAIQEAYEVLIDPVRRRIYDSTDEFDDEIPAECAPQDFFKVFGPAFLRNGRWSVTQPVPSLGDENTPLKEVETFIISGTASKAG
ESS
Predicted Coding Sequence 
XAGGAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATTGATCCTGTTAGGAGAAGGATTTATGACTCCACAGAT
GAATTTGATGATGAAATCCCAGCTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTCTTAAGGAATGGACGATGGTCC
GTCACCCAGCCTGTCCCATCGTTAGGTGATGAGAATACTCCACTTAAAGAAGTGGAAACTTTTATAATTTCTGGTACGGCTTCAAAAGCT
GGAGAGAGTTCC\
Edits in Original Sequence 
(5')XAGGAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATTGATCCTGTTAGGAGAAGGATTTATGACTCCAC
AGATGAATTTGATGATGAAATCCCAGCTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTCTTAAGGAATGGACGATG
GTCCGTCACCCAGCCTGTCCCATCGTTAGGTGATGAGAATACTCCACTTAAAGAAGTGGAtAACTTTTATAATTTCTGGTACGGCTTCAA
AAGCTGGAGAGAGTTCC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan