ESTScan Details for Unigene SGN-U209464

Score 
107
Direction 
Forward
Predicted Peptide Sequence 
HGMFDLHVIIFNAVFNRHITIRRRGQSGFGRYHGKYSFDTFSHEKAVLHRSYLIELEPRYPPWNDFKLDFVRLAYNFDYIGLXTALVGFE
KNIQNQSKAVKYKSSESQRAI
Predicted Coding Sequence 
XCTGXACATGGGATGTTTGATTTGCATGTCATAATTTTCAATGCAGTTTTTAACCGACACATTACCATTCGGAGGCGTGGTCAGAGTGGT
TTCGGACGTTACCATGGGAAGTATTCATTTGACACATTCAGTCATGAAAAAGCAGTTCTGCATAGGAGCTACTTAATTGAGTTGGAGCCA
AGGTATCCTCCATGGAATGATTTCAAGCTGGACTTTGTTAGATTGGCCTACAACTTTGATTATATTGGGCTTGXTACTGCTCTTGTTGGG
TTTGAAAAGAATATTCAGAATCAATCGAAGGCAGTAAAGTATAAATCTTCTGAGTCACAAAGGGCAATC\
Edits in Original Sequence 
(5')XCTGXACATGGGATGTTTGATTTGCATGTCATAATTTTCAATGtCAGTTTTTAACCGACACATTACCATTCGGAGGCGTGGTCAGA
GTGGTTTCGGACGTTACCATGGGAAGTATTCATTTGACACATTCAGTCATGAAAAAGCAGTTCTGCATAGGAGCTACTTAATTGAGTTGG
AGCCAAGGTATCCTCCATGGAATGATTTCAAGCTGGACTTTGTTAGATTGGCCTACAACTTTGATTATATTGGGCTTGXTACTGCTCTTG
TTGGGTTTGAAAAGAATATTCAGAATCAATCGAAGGCAGTAAAGTATAAATCTTCTGAGTCACAAAGGGCAATC\(3')CATCAAACAAT
GCCTTACCAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan