Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U209501

Score 
181
Direction 
Forward
Predicted Peptide Sequence 
KLDLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVXPPAAKAEEKEGEVSKSLLDIVINCSSNDIAG
HNSVVIPPWYPFVFLRLRGSRRYLFALFKTTNDXLVSVQWLGLLVSFVVSVIEXTANCRPL
Predicted Coding Sequence 
XCAAAACTTGATCTTCGGGATGATAAGCAATTCTTCATAGACCATCCTGGTGCTGTGCCAATTACTACTGCTCAAGGTGAGGAGCTAAGG
AAAACAATTGGTGCACCTGCTTACATTGAATGTAGTTCAAAAACACAACAGAATGTGAAAGCAGTCTTCGATGCTGCCATTAAGGTTGXT
CCTCCAGCCGCCAAAGCAGAAGAAAAAGAAGGGGAAGTCTCAAAAAGCCTGCTCGATATTGTGATCAACTGTAGTTCCAACGATATTGCT
GGTCACAATTCTGTTGTAATCCCTCCCTGGTATCCCTTTGTCTTCCTTCGTCTCAGAGGAAGTAGGAGGTACTTGTTTGCCTTATTTAAA
ACTACTAACGATXCTCTTGTAAGTGTCCAGTGGCTTGGTTTACTTGTATCATTTGTGGTCTCTGTTATTGAGXTCACAGCAAATTGTAGG
CCACTCTAG\
Edits in Original Sequence 
(5')XCAAAACTTGATCTTCGGGATGATAAGCAATTCTTCATAGACCATCCTGGTGCTGTGCCAATTACTACTGCTCAAGGTGAGGAGCT
AAGGAAAACAATTGGTGCACCTGCTTACATTGAATGTAGTTCAAAAACACAACAGAATGTGAAAGCAGTCTTCGATGCTGCCATTAAGGT
TGXTCCTCCAGCCGCCAAAGCAGAAGAAAAAGAAGGGGAAGTCTCAAAAAGCCTGCTCGATATTGTGATCAACTGTAGTTCCAACGATAT
TGCTGGTCACAATTCTcGTTGTAATCCCTCCCTGGTATCCCTTTGTCTTCCTTCGTCTCAGAGGAAGTAGGAGGTACTTGTTTGCCTTAT
TTAAAACTACTAACGATXCTCTTGTAAGTGTCCAGTGGCTTGGTTTACTTGTATCATTTGTGGTCTCTaGTTATTGAGXTCACAGCAAAT
TGTAGGCCACTCTAG\(3')CGTGCCCTTTGTTTTCATTTGCTTTTATGTATTAACGACTGAATGATCCAGTTAGGAAAACAGTTTTTTT
GCAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan