ESTScan Details for Unigene SGN-U209594

Score 
480
Direction 
Forward
Predicted Peptide Sequence 
RAVLAQKKEPNLWSQDLEXDQGRNLNDLELFDGDESNSISDLTAFQLSTDHSTSVEEEVKRIRSEHPDDACALMNDRVKGSLKVTRAFGA
GFLKQPKWNNALLEMFRIDYXGTSPYISCLPSLYHHRLGPRDRFLILSSDGLYQYFTNEEAVLEVEHFISWSPDGDPAQHLIEKVLFRAA
KK
Predicted Coding Sequence 
XGTCGAGCTGTGTTAGCTCAGAAGAAAGAGCCTAATCTATGGAGCCAAGATTTAGAGCXGGATCAAGGAAGAAACTTGAATGATCTTGAG
CTTTTTGATGGCGATGAGTCGAATAGTATATCTGATTTAACTGCTTTTCAGCTTAGTACAGATCATAGCACCTCTGTCGAAGAGGAAGTT
AAAAGAATAAGAAGTGAACATCCAGATGATGCCTGTGCTTTGATGAATGACCGTGTGAAAGGTTCTTTGAAGGTCACTCGGGCTTTTGGT
GCTGGTTTCCTGAAACAGCCTAAATGGAACAATGCACTTCTGGAAATGTTCAGAATTGACTATATNGGAACTTCACCCTACATCAGTTGT
CTTCCATCTCTCTATCATCACAGGTTAGGGCCAAGAGACAGGTTTTTGATACTGTCATCTGATGGGCTCTATCAGTACTTCACAAATGAA
GAAGCTGTTTTAGAAGTTGAACATTTCATCTCATGGTCACCAGATGGAGATCCAGCACAACATCTCATTGAGAAAGTGTTGTTCCGCGCT
GCAAAAAAA\
Edits in Original Sequence 
(5')XGTCGAGCTGTGTTAGCTCAGAAGAAAGAGCCTAATCTATGGAGCCAAGATTTAGAGCXGGATCAAGGAAGAAACTTGAATGATCT
TGAGCTTTTTGATGGCGATGAGTCGAATAGTATATCTGATTTAACTGCTTTTCAGCTTAGTACAGATCATAGCACCTCTGTCGAAGAGGA
AGTTAAAAGAATAAGAAGTGAACATCCAGATGATGCCTGTGCTTTGATGAATGACCGTGTGAAAGGTTCTTTGAAGGTCACTCGGGCTTT
TGGTGCTGGTTTCCTGAAACAGCCTAAATGGAACAATGCACTTCTGGAAATGTTCAGAATTGACTATATNGGAACTTCACCCTACATCAG
TTGTCTTCCATCTCTCTATCATCACAGGTTAGGGCCAAGAGACAGGTTTTTGATACTGTCATCTGATGGGCTCTATCAGTACTTCACAAA
TGAAGAAGCTGTTTTAGAAGTTGAACATTTCATCTCATGGTCACCAGATGGAGATCCAGCACAACATCTCATTGAGAAAGTGTTGTTCCG
CGCTGCAAAAAAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan