ESTScan Details for Unigene SGN-U209778

Score 
652
Direction 
Forward
Predicted Peptide Sequence 
MRVGDYMAVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPNDKTNVHLIYANVTYEDILLKEELDGLAANYPDRFNIYYVL
NQPPEVWSGGVGFVSKEMIQTQCPAPAADIKILRCGPPPMNKAMAAHLEALGYSSEMQFQF
Predicted Coding Sequence 
ATGCGTGTGGGTGATTATATGGCAGTGAAGGGACCCAAGGGGCGCTTTAAGTACCAGCCTGGCCAAGTAAGAGCATTTGGAATGCTTGCT
GGAGGCTCTGGCATTACCCCAATGTTCCAGGTTGCTAGAGCTATTCTTGAAAATCCTAATGACAAGACAAATGTGCACCTAATCTATGCT
AATGTTACTTATGAAGATATTCTTCTGAAGGAAGAGTTGGACGGCCTTGCTGCTAACTATCCTGACCGTTTCAATATTTATTACGTATTG
AATCAGCCTCCTGAAGTATGGAGTGGTGGTGTAGGATTTGTCTCTAAGGAAATGATCCAGACTCAATGCCCTGCTCCAGCTGCTGACATT
AAGATACTAAGGTGTGGTCCACCACCGATGAATAAGGCTATGGCTGCTCATCTTGAAGCTCTTGGATATTCATCAGAGATGCAATTCCAA
TTCTAA\
Edits in Original Sequence 
AA(5')ATGCGTGTGGGTGATTATATGGCAGTGAAGGGACCCAAGGGGCGCTTTAAGTACCAGCCTGGCCAAGTAAGAGCATTTGGAATG
CTTGCTGGAGGCTCTGGCATTACCCCAATGTTCCAGGTTGCTAGAGCTATTCTTGAAAATCCTAATGACAAGACAAATGTGCACCTAATC
TATGCTAATGTTACTTATGAAGATATTCTTCTGAAGGAAGAGTTGGACGGCCTTGCTGCTAACTATCCTGACCGTTTCAATATTTATTAC
GTATTGAATCAGCCTCCTGAAGTATGGAGTGGTGGTGTAGGATTTGTCTCTAAGGAAATGATCCAGACTCAATGCCCTGCTCCAGCTGCT
GACATTAAGATACTAAGGTGTGGTCCACCACCGATGAATAAGGCTATGGCTGCTCATCTTGAAGCTCTTGGATATTCATCAGAGATGCAA
TTCCAATTCTAA\(3')CTTCCTATTTTTTGTTTTTATTTTTGTCCCAACATTGATGTTAACCCTACTTGGAGGGGGTTATATTACAGGG
TGGGAAACCGACATTGTCATTTGCATATTACTGGATTGTAGGTCTGTTTAACAGAGTTTCAGCGACGTGACTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan