ESTScan Details for Unigene SGN-U209888

Score 
135
Direction 
Forward
Predicted Peptide Sequence 
RTYVHEKVYDEFVEKAKARALKRTVGDPFKRPEQGPQIVKXNLKDHEVIRSGVDGGATLETGGEQLGEKGSILSPQFSHVKDDMLIDRMR
FLVSAVILDXNDLDDMX
Predicted Coding Sequence 
XCTCGGACCTATGTTCACGAGAAAGTTTATGATGAATTTGTGGAGAAGGCAAAGGCACGTGCCTTGAAGCGCACTGTTGGCGATCCATTT
AAAAGGCCTGAGCAGGGTCCTCAGATTGTTAAAAXCAATTTGAAAGATCATGAGGTCATTAGATCTGGTGTTGATGGCGGAGCTACTCTT
GAAACTGGAGGTGAGCAGCTTGGTGAAAAGGGCTCTATATTAAGCCCACAGTTTTCTCATGTTAAGGATGATATGCTGATTGACAGGATG
AGATTTTTGGTCAGTGCAGTCATCTTAGATTTXAATGATCTTGATGACATGAXX\
Edits in Original Sequence 
(5')XCTCGGACCTATGTTCACGAGAAAGTTTATGATGAATTTGTGGAGAAGGCAAAGGCACGTGCCTTGAAGCGCACTGTTGGCGATCC
ATTTAAAtAGGCCTGAGCAGGGTCCTCAGATTGaTTAAAAXCAATTTGAAAGATCATGAGGTCATTAGATCTGGTGTTGATGGCGGAGCT
ACTCTTGAAACTGGAGGTGAGCAGCTTGGTGAAAAGGGCTCTATATTAAGCCCACAGTTTTCTCtATGTTAAGGATGATATGCTGATTGA
CAGGATGAGATTTTTGGTCAGTGCAGTCATCTTAGATTTXAATGATCTTGATGACATGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan