ESTScan Details for Unigene SGN-U210021

Score 
-30
Direction 
Forward
Predicted Peptide Sequence 
SAAAKRSSIPRMPDGTKGFCIGRGKPVAIXNNGRLSTYLKRRACHVNISIQRMGLFPSFAGIDGRVFXNAVNPVELERWLILAARVKRFI
CGLLLNPEPHTEAAX
Predicted Coding Sequence 
XXGTCAGCAGCAGCCAAGCGATCTTCTATACCTCGCATGCCGGATGGCACCAAGGGATTCTGCATAGGTCGAGGTAAACCAGTGGCTATT
AAXAACAATGGACGACTCTCTACTTACTTGAAAAGGCGGGCTTGTCACGTGAACATTTCTATACAGAGGATGGGATTGTTTCCTAGTTTT
GCGGGTATTGATGGCAGGGTTTTTXTAAACGCTGTCAATCCAGTGGAGCTGGAGCGATGGTTGATTTTGGCTGCTCGAGTCAAGAGGTTC
ATCTGTGGTCTATTACTAAATCCTGAACCCCACACGGAAGCTGCGTXX\
Edits in Original Sequence 
(5')XXGTCAGCAGCAGCCAAGCGATCTTCTATACCTCGCATGCCGGATGGCACCAAGGGATTCTGCATAGGTCGAGGTAAACCAGTGGC
TATTAAXAACAATGtGACGACTCTCTACTTACTTGAAAAGGCGGGCTTGTCACGTGAACATTTCTATACAGAGGATGGGATTGTTTCCTA
GTTTTGCGGGTATTGATGGCAGGGTTTTTXTAAACGCTGTCAATCCAGTGGAGCTGGAGCGATGGTTGATTTTGGCTGCTCGAGTCAAGA
GGTTCATCTGTGGTCTATTACTAAATCCaTGAACCCCACACGGAAGCTGCGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan