ESTScan Details for Unigene SGN-U210071

Score 
150
Direction 
Forward
Predicted Peptide Sequence 
AKLALKCCELRRKDRPDLGSVILPELVRLKDIASDYKPRSRFTSYPTSSPESLVVSEVGTRNNSGNQSDKVPNSCNAKNVXNYFQEAEVF
LVPIDKGDIRWSPPQHSSIFLAPLHM
Predicted Coding Sequence 
GCTAAATTGGCTTTGAAATGTTGTGAACTCAGGAGGAAGGACAGGCCAGACCTTGGTTCAGTCATATTGCCTGAATTGGTACGACTAAAA
GACATTGCATCCGATTATAAGCCTAGAAGTCGATTTACTTCATATCCCACAAGTTCACCAGAAAGCTTAGTAGTGAGTGAGGTAGGAACA
AGAAACAATTCTGGCAATCAATCTGATAAAGTACCAAATAGCTGCAATGCAAAAAACGTCXTAAATTACTTCCAAGAAGCCGAGGTCTTT
CTAGTACCTATTGACAAAGGTGATATACGCTGGTCTCCTCCTCAACATTCAAGCATTTTTTTGGCTCCACTGCATATGTGA\
Edits in Original Sequence 
(5')GCTAAATTGGCTTTGAAATGTTGTGAACTCAGGAGGAAGGACAGGCCAGACCTTGGTTCAGTCATATTGCCTGAATTGGTACGACT
AAAAGACATTGCATCCGATTATAAGCCTAGAAGTCGATTTACTTCATATCCCACAAGTTCACCAGAAAGCTTAGTAGTGAGTGAGGTAGG
AACAAGAAACAATTCTGGCAATCAATCTGATAAAGTACCAtAATAGCTGCAATGCAAAAAACGTCXTAAATTACTTCCAAGAAGCCGAGG
TCTTTCTAGTACCTATTGACAAAGGTGATATACGCTGGTCTCCTCCTCAACATTCAAGCATTTTTTTGGCTCCACTGCATATGTGA\(3')
ATATTAAATGTAAAGAGATAACAATATAGAATCACCACCACAACCCCCCATTTTGTAATTTTTGAAACTGGAAAAACAAAGATCAAGAA
AACAAGCCAATTATGATCCCAGTGAACGTCATAGTAAATGGAATTCTTGTACACCAAATGATATTCTAATGAAATGTTGTCATTTTTTTT
TCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan