Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U210089

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
TAPEYAIHGHLTEKVDVYSFGVVVLEIISGRRSNDMQIEPVTEYLLEQAWKLHETGMPEQLVDETLDPSEYSEQDVKKIVEIALTCTQSP
ANLRPSMSEVVVMLLSDRSTDTRTPSRPSIFSMEKRTPLDLSATTGSSASNATNTFTDFTGR
Predicted Coding Sequence 
ACTGCACCAGAATATGCAATTCATGGACATCTAACAGAGAAGGTTGATGTCTATAGCTTTGGTGTTGTTGTTCTTGAAATAATCAGTGGC
CGGAGGAGCAATGATATGCAAATTGAGCCTGTCACGGAATATCTCCTTGAACAGGCATGGAAACTTCACGAAACTGGCATGCCTGAGCAA
TTGGTGGATGAGACTTTAGACCCCAGTGAATATAGCGAACAAGATGTGAAGAAAATCGTAGAGATTGCCTTAACATGTACACAGTCACCA
GCAAATCTTAGGCCAAGCATGTCTGAAGTTGTTGTCATGCTATTAAGTGATCGTAGCACAGACACGAGAACTCCTAGTAGGCCTTCTATC
TTTAGCATGGAAAAGAGGACACCACTGGACTTATCCGCGACAACTGGATCATCAGCTTCTAATGCAACCAACACTTTTACTGATTTCACT
GGCCGCTAG\
Edits in Original Sequence 
(5')ACTGCACCAGAATATGCAATTCATGGACATCTAACAGAGAAGGTTGATGTCTATAGCTTTGGTGTTGTTGTTCTTGAAATAATCAG
TGGCCGGAGGAGCAATGATATGCAAATTGAGCCTGTCACGGAATATCTCCTTGAACAGGCATGGAAACTTCACGAAACTGGCATGCCTGA
GCAATTGGTGGATGAGACTTTAGACCCCAGTGAATATAGCGAACAAGATGTGAAGAAAATCGTAGAGATTGCCTTAACATGTACACAGTC
ACCAGCAAATCTTAGGCCAAGCATGTCTGAAGTTGTTGTCATGCTATTAAGTGATCGTAGCACAGACACGAGAACTCCTAGTAGGCCTTC
TATCTTTAGCATGGAAAAGAGGACACCACTGGACTTATCCGCGACAACTGGATCATCAGCTTCTAATGCAACCAACACTTTTACTGATTT
CACTGGCCGCTAG\(3')CAACATAAACTTTACTGTATATCTGAAAATTATATTGGCACCATAACATCTAGCAAGCCAATTTCTTCCTCT
TTTCTTTTACTTTTTCCAAATGGTAAGATAGATCATTTGTGTAACTAGATAAAGTGAGATATAGGATGAGTGAAGCTATGATTTATGAAA
TATAAAATTCCCACAAGTGGTGAGAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan