ESTScan Details for Unigene SGN-U210180

Score 
250
Direction 
Forward
Predicted Peptide Sequence 
VGGGIVKVPPEKHYHAMPSEIGEFGSNGSEDEIKCTICQEEYVIGDEIGRLECEHGYHVNCXTALVEAQELVSYMQSFSSSITFTAIHKT
ILVSNLDSIPDVGNSKSFSMYKFIKLGTCN
Predicted Coding Sequence 
GTCGGAGGAGGAATTGTCAAAGTGCCTCCGGAAAAGCATTATCATGCTATGCCTTCAGAAATAGGGGAATTTGGTAGCAATGGGAGTGAA
GATGAGATCAAATGCACTATTTGCCAGGAGGAGTATGTGATTGGAGATGAAATAGGAAGGTTGGAATGTGAGCATGGGTATCATGTGAAT
TGTGXTACAGCATTGGTTGAAGCTCAAGAATTGGTGTCCTATATGCAAAGCTTCAGCAGCTCCATCACATTCACAGCCATCCACAAAACC
ATCTTAGTTTCAAATTTAGATTCCATCCCAGATGTTGGAAACTCAAAAAGTTTCAGTATGTACAAATTCATCAAGCTGGGAACTTGCAAC
TAA\
Edits in Original Sequence 
(5')GTCGGAGGAGGAATTGTCAAAGTGCCTCCGGAAAAGCAtTTATCATGCTATGCCTTCAGAAATAGGGGAATTTGGTAGCAATGGGA
GTGAAGATGAGATCAAATGCACTATTTGCCAGGAGGAGTATGTGATTGGAGATGAAATAGGAAGGTTGGAATGTGAGCATGGGTATCATG
TGAATTGTGXTACAGCATTGGTTGAAGCTCAAGAATTGGTGTCCTATATGCAAAGCTTCAGCAGCTCCATCACATTCACAGCCATCCACA
AAACCATCTTAGTTTCAAATTTAGATTcCCATCCCAGATGTTGGAAACTCAAAAAGTTTCAGTATGTACAAATTCATCAAGCTGGGAACT
TGCAACTAA\(3')ACTTTCCTTTTCTTTTTCTCTATCTTTCTTTTTTTTTTTTGGGGTTGCGGGGGGAGGGGCTCTTCTGTTCTTTGTT
TCAATTTTTTCACTTTTGTACATATACAGTTCTTGTCACATTGACCAATAAACTCAAGCTTTTACAGGCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan