ESTScan Details for Unigene SGN-U210288

Score 
390
Direction 
Forward
Predicted Peptide Sequence 
LGLLSGKHIPPGHALDMIRXQKHSSVDGFTFGGNFSTEEATVVLDLASRCLQYEPRERPNIKDLVTTLSPLQSKPEVASHVMLGIPKPEE
APPTPQHPLSAMGDACSRMDLTAIHQILVMTHYKDDEGTNELSFQEWTQQMRDMLEARKRGDLAFSGQGIQNWHRLLFSVQDVGTMVSPT
VNARRSLCYLMCDQPDAALRDA
Predicted Coding Sequence 
CTTGGACTCCTAAGTGGAAAGCATATCCCTCCCGGTCATGCACTTGATATGATACGCGXGCAAAAACATTCTTCTGTTGATGGATTCACA
TTTGGAGGAAATTTCTCCACTGAAGAGGCAACGGTGGTCCTTGATCTGGCTTCGAGATGCTTGCAATACGAACCTAGGGAGCGACCAAAT
ATCAAAGATCTTGTTACAACACTTAGTCCTTTACAAAGTAAACCTGAAGTTGCGTCTCATGTGATGCTCGGAATTCCTAAGCCTGAGGAA
GCTCCTCCAACTCCACAGCACCCTCTTTCTGCCATGGGTGATGCTTGTTCAAGAATGGATCTCACAGCCATTCATCAAATTTTGGTGATG
ACCCACTACAAAGATGACGAAGGGACAAATGAGTTGTCTTTCCAAGAATGGACTCAACAAATGAGGGATATGTTAGAGGCAAGGAAGCGT
GGGGACTTGGCATTTTCGGGACAAGGAATTCAAAACTGGCATAGATTGTTATTCTCAGTTCAAGATGTCGGAACGATGGTATCACCAACC
GTTAATGCTCGGAGAAGCCTTTGTTATCTTATGTGTGATCAACCTGATGCGGCCCTTAGAGATGCA\
Edits in Original Sequence 
(5')CTTGGACTCCTAAGTGGAAAGCATATCCCTCCCGGTCATGCACTTGATATGATACGCGXGCAAAAACATTCTTCTGTTGATGGATT
CACATTTGGAgGGAAATTTCTCCACTGAAGAGGCAACGGTGGTCCTTGATCTGGCTTCGAGATGCTTGCAATACGAACCTAGGGAGCGAC
CAAATATCAAAGATCTTGTTACAACACTTAGTCCTTTACAAAGTAAACCTGAAGTTGCGTCTCATGTGATGCTCGGAATTCCTAAGCCTG
AGGAAGCTCCTCCAACTCCACAGCACCCTCTTTCTGCCATGGGTGATGCTTGTTCAAGAATGGATCTCACAGCCATTCATCAAATTTTGG
TGATGACCCACTACAAAGATGACGAAGGGACAAATGAGTTGTCTTTCCAAGAATGGACTCAACAAATGAGGGATATGTTAGAGGCAAGGA
AGCGTGGGGACTTGGCATTTTCGGGACAAGGAATTCAAAACTGGCATAGATTGTTATTCTCAGTTCAtAGATGTCGGAACGATGGTATCA
CCAACCGTTAATGCTCGGAGAAGCCTTTGTTATCTTATGTGTGATCAACCTGATGCGGCCCTTAGAGATGCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan