ESTScan Details for Unigene SGN-U210330

Score 
154
Direction 
Forward
Predicted Peptide Sequence 
LKNDFHFIPQLSPTSSSLFFSDCPILSPPSFIKLQQKSTSFSDDLRQPAPSHQRRXVSTSPAGSFYETLGISMNTMSEDIKAAYRRLARV
YHPDVAAKDMSVEEFMKIHAAYCSYQIMKSVPIMIGACFGVV
Predicted Coding Sequence 
CTCAAAAATGATTTCCACTTCATTCCTCAGCTATCGCCGACGTCCAGCTCATTATTCTTTAGCGACTGTCCCATTCTCTCACCGCCGTCA
TTCATCAAACTCCAGCAGAAATCTACTTCCTTCTCCGACGATTTGCGACAACCTGCACCATCACATCAACGCCGTAXAGTTTCTACGTCT
CCGGCGGGTTCGTTTTACGAAACTCTTGGAATTTCGATGAACACAATGAGCGAGGATATCAAGGCAGCATATAGGAGATTAGCTAGAGTT
TATCATCCAGATGTTGCTGCAAAGGACATGTCAGTAGAGGAGTTCATGAAGATTCATGCTGCTTATTGTAGCTATCAGATCATGAAAAGT
GTGCCGATTATGATCGGCGCGTGTTTCGGAGTAGTATAG\
Edits in Original Sequence 
(5')CTCAAAAATGATTTCCACTTCATTCCgTCAGCTATCGCCGACGTCCAGCTCATTATTCTTTAGCGACTGTCCCATTCTCTCACCGC
CGTCATTCATCAAACTCCAGCAGAAATCTACTTCCTTCTCCGACGcATTTGCGACAACCTGCACCATCACATCAACGCCGTAXAGTTTCT
ACGTCTCCGGCGGGTTCGTTTTACGAAACTCTTGGAATTTCGATGAACACAATGAGCGAGGATATCAAGGCAGCATATAGGAGATTAGCT
AGAGTTTATCATCCAGATGTTGCTGCAAAGGACATGTCAGTAGAGGAGTTCATGAAGATTCATGCTGCTTATTGTAcGCTATCAGATCAT
GAAAAGTGTGCCGATTATGATCGGCGCGTGTTTCGGAGTAGTATAG\(3')TTAGTCTGTATTCCCCCCGCTATACTTTCCGAAATTGGG
AGACTGATCAGTGCTGGTAGCAATTTCTAATGGAGAAACTTAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan