ESTScan Details for Unigene SGN-U210355

Score 
542
Direction 
Forward
Predicted Peptide Sequence 
ATFGDYCTSFLQLTKNYLITSVTSPTELTTNNVLLDMFTLYFPTFTAASTTFPFNYSKPTKKTPSSNQTSTPLPTTTLISKTFQQEPISE
TPSSAQWIDTLRSQVRLNCFKDAIFTYVHMISEGIRPDNFVFPAVLKAVTGLQDLNLGKQIHGSVVKFGYXYDIGNRGEFPYPFVWEMWW
EHHDVYRVFDRITQRDQVSWNSLINALCKSEKWELALEAFRLMGX
Predicted Coding Sequence 
XXCGCAACCTTCGGTGATTATTGCACATCATTTCTGCAGTTAACTAAAAACTACCTTATCACTTCTGTTACTTCACCAACTGAATTAACC
ACCAACAATGTCCTCTTGGACATGTTCACTCTCTACTTCCCCACTTTCACTGCCGCTTCAACAACCTTCCCATTCAATTACTCAAAACCC
ACCAAGAAAACACCTTCTTCAAACCAAACTTCAACCCCTTTACCCACAACTACACTCATTTCAAAGACATTTCAACAAGAACCCATTTCT
GAAACACCCTCTTCAGCTCAATGGATCGATACTCTTCGATCCCAAGTACGCTTAAATTGCTTCAAAGATGCAATCTTTACATATGTACAT
ATGATTAGTGAAGGTATTAGACCTGATAATTTTGTATTCCCTGCAGTTCTGAAAGCTGTTACTGGCCTTCAGGACTTGAATCTTGGAAAA
CAGATACATGGTTCTGTTGTTAAATTTGGATATGAXTACGACATCGGTAACCGTGGCGAATTCCCTTATCCATTTGTTTGGGAAATGTGG
TGGGAGCACCATGATGTTTATAGAGTGTTTGATAGAATTACACAAAGAGATCAAGTTTCTTGGAATTCTTTGATAAATGCTCTTTGTAAG
TCTGAGAAGTGGGAGTTGGCATTAGAGGCCTTTAGGTTGATGGGGTXX\
Edits in Original Sequence 
(5')XXCGCAACCTTCGGTGATTATTGCACATCATTTCTGCAGTTAACTAAAAACTACCTTATCACTTCTGTTACTTCACCAACTGAATT
AACCACCAACAATGTCCTCTTGGACATGTTCACTCTCTACTTCCCCACTTTCACTGCCGCTTCAACAACCTTCCCATTCAATTACTCAAA
ACCCACCAAGAAAACtACCTTCTTCAAACCAAACTTCAACCCCTTTACCCACAACTACACTCATTTCAAAGACATTTCAACAAGAACCCA
TTTCTGAAACACCCTCTTCAGCTCAATGGATCGATACTCTTCGATCCCAAGTACGCTTAAATTGCTTCAAAGATGCAATCTTTACATATG
TACATATGATTAGTGAAGGTATTAGACCTGATAATTTTGTATTCCCTGCAGTTCTGAAAGCTGTTACTGGCCTTCAGGACTTGAATCTTG
GAAAACAGATACATGGTTCTGTTGTTAAATTTGGATATGAXTACGACATCGGTAACCGTGGCGAATTCCCTTATCCATTTGTTTGGGAAA
TGTGGTGGGAGCAtCCATGATGTTTATAGAGTGTTTGATAGAATTACACAAAGAGATCAAGTTTCTTGGAATTCTTTGATAAATGCTCTT
TGTAAGTCTGAGAAGTGGGAGTTGGCATTAGAGGCCTTTAGGTTGATGGGGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan