ESTScan Details for Unigene SGN-U210371

Score 
315
Direction 
Forward
Predicted Peptide Sequence 
ELFESLGIAQPKGVLLYGPPGTGKTCWRGQLRIILIVPSFGSXGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG
SGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPKKSPRFDILKIHSRKMNLMRGIDLKKIAEKM
NGASGAELKAVX
Predicted Coding Sequence 
GAACTATTTGAGTCTCTTGGAATAGCTCAACCTAAGGGAGTGCTGCTTTACGGGCCTCCAGGAACAGGAAAAACATGTTGGCGAGGGCAG
TTGCGCATCATACTGATTGTACCTTCATTCGGGTCTXCTGGTTCTGAACTAGTGCAAAAATACATTGGAGAAGGTTCTCGTATGGTGAGA
GAACTCTTTGTTATGGCCAGGGAACATGCACCTTCTATCATATTTATGGATGAAATAGACAGTATTGGATCTGCTAGAATGGAATCGGGA
AGTGGCAATGGTGATAGTGAAGTGCAGAGGACAATGCTGGAGCTTCTTAATCAGCTTGATGGATTCGAGGCATCAAACAAAATTAAGGTT
TTGATGGCTACAAACCGTATTGATATTCTGGATCAAGCACTCCTGAGACCAGGAAGAATTGACAGGAAGATTGAATTTCCAAATCCCAAG
AAGAGTCCXCGTTTCGACATTTTAAAGATCCATTCTAGGAAGATGAACTTGATGCGAGGCATTGACTTGAAGAAAATTGCAGAGAAGATG
AATGGTGCTTCTGGGGCAGAACTTAAGGCTGTCTGX\
Edits in Original Sequence 
(5')GAACTATTTGAGTCTCTTGGAATAGCTCAACCTAAGGGAGTGCTGCTTTACGGGCCTCCAGGAACAGGAAAAACATGTTGGCGAGG
GCAGTTGCGCATCATACTGATTGTACCTTCATTCGGGTCTXCTGGTTCTGAACTAGTGCAAAAATACATTGGAGAAGGTTCTCGTATGGT
GAGAGAACTCTTTGTTATGGCCAGGGAACATGCACCTTCTATCATATTTATGGATGAAATAGACAGTATTGGATCTGCTAGAATGGAATC
GGGAAGTGGCAATGGTGATAGTGAAGTGCAGAGGACAATGCTGGAGCTTCTTAATCAGCTTGATGGATTCGAGGCATCAAACAAAATTAA
GGTTTTGATGGCTACAAACCGTATTGATATTCTGGATCAAGCACTCCTGAGACCAGGAAGAATTGACAGGAAGATTGAATTTCCAAATCC
CAAtGAAGAGTCCXCGTTTCGACATTTTAAAGATCCATTCTAGGAAGATGAACTTGATGCGAGGCATTGACTTGAAGAAAATTGCAGAGA
AGATGAATGGTGCTTCTGGGGCAGAACTTAAGGCTGTCTGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan