ESTScan Details for Unigene SGN-U210389

Score 
371
Direction 
Forward
Predicted Peptide Sequence 
GKSTVISLIERFYNPEXGRNIFGWCRNQTIQTKLAKAANGVGGQEPVLFNETIRENIAYSRQGNATEEEIIQAAKSANAHNFISSLPQGY
DTSVGERGVQLSGGQKQRIAIARAILKDPKILLLDEATSALDAESERIVQEALDRVMVNRTTVVVAHRLSTIKGADIIAVVKNGVIAX
Predicted Coding Sequence 
GGAAAATCAACTGTCATTAGCCTAATAGAGAGGTTCTATAATCCTGAAXTCGGGAGAAATATATTTGGATGGTGTAGAAATCAGACAATT
CAAACTAAGTTGGCTAAGGCAGCAAATGGGGTTGGTGGTCAAGAACCAGTACTGTTTAACGAAACGATTAGAGAGAACATTGCCTACAGC
AGACAAGGGAATGCAACAGAAGAAGAGATCATTCAAGCAGCAAAATCAGCAAATGCACACAACTTTATATCCTCATTGCCTCAAGGATAT
GATACATCAGTTGGGGAAAGAGGGGTACAATTATCAGGTGGACAAAAGCAAAGGATTGCTATTGCAAGAGCAATACTGAAGGATCCAAAG
ATCCTTTTGCTAGACGAGGCAACAAGTGCGTTAGATGCAGAATCAGAACGTATTGTACAAGAAGCATTGGATCGAGTGATGGTAAATAGA
ACAACGGTGGTTGTAGCTCATCGCTTAAGCACAATCAAAGGGGCAGATATCATTGCTGTTGTGAAGAATGGAGTAATTGCTGXX\
Edits in Original Sequence 
(5')GGAAAATCAACTGTCATTAGCCTAATAGAGAGGTTCTATAATCCTGAAXTCGGGAGAAATATATTTGGATGGTGTAGAAATCAGAC
AATTCAAACTAAGTTGGCTAAGGCAGCAAATGGGGTTGGTGaGTCAAGAACCAGTACTGTTTAACGAAACGATTAGAGAGAACATTGCCT
ACAGCAGACAAGGGAATGCAACAGAAGAAGAGATCATTCAAGCAGCAAAATCAGCAAATGCACACAACTTTATATCCTCATTGCCTCAAG
GATATGATACATCAGTTGGGGAAAGAGGGGTACAATTATCAGGTGGACAAAAGCAAAGGATTGCTATTGCAAGAGCAATACTGAAGGATC
CAAAGATCCTTTTGCTAGACGAGGCAACAAGTGCGTTAGATGCAGAATCAGAACGTATTGTACAAGAAGCATTGGATCGAGTGATGGTAA
ATAGAACAACGGTGGTTGTAGCTCATCGCTTAAGCACAATCAAAGGGGCAGATATCATTGCTGTTGTGAAGAATGGAGTAATTGCTGXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan