ESTScan Details for Unigene SGN-U210454

Score 
376
Direction 
Forward
Predicted Peptide Sequence 
LDLALGSFPKXPVLFEGTVRSNIDPIGQYSDDEIWQSLERCQLKDVVSSKPEKLDSPVVDNGDNWSVGQRQLLCLGRVMLKRSRLLFMDE
ATASVDSQTDAVIQKIIREDFAACTIISIAHRIPTVMDCDRVLVVDAGIAKEFDKPSRLLERX
Predicted Coding Sequence 
XXCTTAGATCTCGCTTTGGGATCATTCCCCAAGAXGCCAGTCCTTTTCGAAGGAACTGTGAGAAGCAACATTGACCCCATTGGACAATAT
TCTGATGATGAGATTTGGCAGAGCCTTGAACGCTGCCAACTCAAAGATGTGGTGTCTTCGAAACCTGAAAAACTTGATTCACCAGTTGTT
GATAATGGAGATAATTGGAGTGTTGGGCAAAGACAGCTTCTCTGCCTGGGAAGAGTGATGCTAAAACGCAGCAGACTTCTATTTATGGAT
GAGGCAACTGCCTCTGTTGATTCACAAACAGATGCTGTGATTCAGAAAATCATCCGTGAGGATTTTGCAGCCTGTACAATAATCAGCATT
GCCCACAGAATACCAACAGTTATGGACTGTGATAGAGTACTTGTTGTCGATGCAGGGATAGCAAAAGAGTTTGACAAACCATCTCGTTTG
CTGGAAAGGCXX\
Edits in Original Sequence 
(5')XXCTTAGATCTCGCTTTGGGATCATTCCCCAAGAXGCCAGTCCTTTTCGAAGGAACTGTGAGAAGCAACATTGACCCCATTGGACA
ATATTCTGATGATGAGATTTGGCAGAGCCTTGAACGCTGCCAACTCAAAGATGTGGTGTCTTCGAAACCTGAAAAACTTGATTCACCAGT
TGTTGATAATGGAGATAATTGGAGTGTTGGGCAAAGACAGCTTCTCTGCCTGGGAAGAGTGATGCTAAAACGCAGCAGACTTCTATTTAT
GGATGAGGCAACTGCCTCTGTTGATTCACAAACAGATGCTGTGATTCAGAAAATCATCCGTGAGGATTTTGCAGCCTGTACAATAATCAG
CATTGCCCACAGAATACCAACAGTTATGGACTGTGATAGAGTACTTGTTGTCGATGCAGGGATAGCAAAAGAGTTTGACAAACCATCTCG
TTTGCTGGAAAGGCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan