ESTScan Details for Unigene SGN-U210538

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
MSHQQGDDADYMADEYEMDYIDDYIDEYHGRDSGGSDSDVDEYDMNYRMQDTSAAEARRGKDIQGIPWERLSITREKYRQTRLEQYKNYE
NIPQSGEASEKNCITTKKGGSFYDFRRNSRSVKXNDSTLPAAESGLGNFLSMMST
Predicted Coding Sequence 
ATGTCCCATCAACAAGGAGATGATGCTGATTACATGGCAGATGAATATGAGATGGATTATATAGATGATTATATTGATGAGTACCATGGC
AGAGACTCGGGTGGCTCTGATTCGGATGTAGATGAGTATGACATGAATTATAGAATGCAAGATACTTCGGCTGCTGAGGCAAGAAGAGGC
AAAGACATTCAAGGAATTCCATGGGAAAGGCTTAGCATAACCAGGGAGAAATACAGGCAAACAAGATTAGAGCAGTATAAGAACTACGAG
AATATTCCTCAATCTGGTGAGGCATCAGAGAAGAATTGCATAACGACAAAGAAAGGGGGTTCATTCTACGATTTCAGACGTAATTCGAGG
TCTGTTAAAXTCAACGATTCTACACTTCCAGCTGCGGAATCTGGTCTGGGCAACTTCTTAAGCATGATGTCTACX\
Edits in Original Sequence 
CAAGAATTGATATTATATTCTCTCTCTTCCACACCTATCGCAATCTAAAAAGACAATTAAATCTCCCTAAATAATAATATCTTTTTAATT
ATTTTGCTTAATTCTTTCTAATTTAGAAATTTGGAGATTCTAGATCAACACAAAGAACCTTGATCATCGTCTTTTTTGCTCCCAAAGGTT
CTAGGCCTGGTCATTTTATTTTGCTACCCGAGCAGATTTAATCATTTAATTGGGGGTATAAA
(5')ATGTCCCATCAACAAGGAGATGAT
GCTGATTACATGGCAGATGAATATGAGATGGATTATATAGATGATTATATTGATGAGTACCATGGCAGAGACTCGGGTGGCTCTGATTCG
GATGTAGATGAGTATGACATGAATTATAGAATGCAAGATACTTCGGCTGCTGAGGCAAGAAGAGGCAAAGACATTCAAGGAATTCCATGG
GAAAGGCTTAGCATAACCAGGGAGAAATACAGGCAAACAAGATTAGAGCAGTATAAGAACTACGAGAATATTCCTCAATCTGGTGAGGCA
TCAGAGAAGAATTGCATAACGACAAAGAAAGGGGGTTCATTCTACGATTTCAGACGTAATTCGAGGTCTGTTAAAXTCAACGATTCTACA
CTTCCAGCTGCGGAATCTGGTCTGGGCAACTTCTTAAGCATGATGTCTACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan