ESTScan Details for Unigene SGN-U210620

Score 
644
Direction 
Forward
Predicted Peptide Sequence 
MLETNARPEDSLFSPGMMRFNGMKGKKLTIIGTVDPVSVVSKLRKFWPAHIISVGPAKEPEKKEEPKKEEGKKEEAKKEGEGKKEDAPKE
EGKKEEPKKEEDAKKDENKKDEPKKEEQKKAQAQPQIMPMPIPFPQHQQYHPAVVGMVPTYRPYYPPPPHMQAMPYRPYYPPPAQTYYQV
HHSV
Predicted Coding Sequence 
ATGTTAGAGACAAACGCAAGGCCTGAAGACAGTCTCTTCTCTCCAGGAATGATGAGATTCAATGGAATGAAAGGCAAGAAATTAACCATT
ATCGGGACAGTTGATCCAGTGAGTGTAGTGAGCAAACTGAGGAAGTTTTGGCCGGCACACATAATCTCAGTAGGACCGGCGAAAGAGCCA
GAGAAGAAAGAGGAACCAAAGAAAGAAGAGGGCAAGAAAGAAGAGGCTAAGAAGGAGGGCGAGGGAAAGAAAGAAGACGCACCAAAGGAG
GAAGGAAAGAAAGAGGAGCCTAAAAAAGAAGAAGACGCTAAGAAGGACGAAAACAAGAAAGACGAACCCAAAAAGGAAGAACAGAAGAAG
GCACAAGCACAGCCACAAATAATGCCAATGCCAATTCCATTCCCACAACATCAACAATATCATCCAGCTGTGGTTGGCATGGTACCGACC
TATCGACCATATTATCCTCCTCCTCCCCATATGCAGGCCATGCCTTATAGGCCATATTACCCCCCTCCTGCACAAACATACTATCAGGTT
CACCACAGCGTG\
Edits in Original Sequence 
AGTTCTCTCTCTCCNCTCTCCTCTGAACTGTTCTCCAATCCATTCTGACTGCAAGAATATAAGAAATTATCTTGAATTTGGAGTTGCAAG
(5')ATGTTAGAGACAAACGCAAGGCCTGAAGACAGTCTCTTCTCTCCAGGAATGATGAGATTCAATGGAtATGAAAGGCAAGAAATTAA
CCATTATCGGGACAGTTGATCCAGTGAGTGTAGTGAGCAAACTGAGGAAGTTTTGGCCGGCACACATAATCTCAGTAGGACCGGCGAAAG
AGCCAGAGAAGAAAGAGGAACCAAAGAAAGAAGAGGGCAAGAAAGAAGAGGCTAAGAAGGAGGGCGAGGGAAAGAAAGAAGACGCACCAA
AGGAGGAAGGAAAGAAAGAGGAGCCTAAAAAAGAAGAAGACGCTAAGAAGGACGAAAACAAGAAAGACGAACCCAAAAAGGAAGAACAGA
AGAAGGCACAAGCACAGCCACAAATAATGCCAATGCCAATTCCATTCCCACAACATCAACAATATCATCCAGCTGTGGTTGGCATGGTAC
CGACCTATCGACCATATTATCCTCCTCCTCCCCATATGCAGGCCATGCCTTATAGGCCATATTACCCCCCTCCTGCACAAACATACTATC
AGGTTCACCACAGCGTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan