Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U210911

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
INKDPFRPHENDEKILGAETPYLSAIGALMYLANNTRPDIAFSVNLLARFSSSPTQRHWNGIKHLFRYLRGTIDKGLFYSSESNLPLIGY
ADAGYLSDPHKGRSQTGYLFTCGGTAISWRSTKQTLVATSSNHAEIIAIHEASRECVWLRLITQHIQEMCGFLKKEIPTILFEDNTACI
Predicted Coding Sequence 
XXCATAAATAAAGATCCATTTCGCCCTCATGAAAATGATGAAAAGATTCTTGGTGCTGAAACACCATATCTTAGTGCAATTGGGGCATTA
ATGTATCTTGCTAATAATACCCGACCAGACATTGCTTTTTCTGTAAACTTATTAGCAAGATTTAGTTCTTCCCCGACACAAAGACACTGG
AATGGTATCAAACATTTATTCAGATACCTCCGAGGAACAATCGACAAAGGTTTGTTTTATTCAAGTGAATCCAACTTGCCACTAATTGGT
TATGCAGATGCAGGATATTTATCAGATCCACATAAAGGTCGATCACAAACAGGCTATTTATTTACTTGTGGAGGCACAGCTATATCATGG
CGCTCAACAAAACAGACTTTAGTTGCTACTTCCTCAAATCATGCAGAAATAATAGCTATTCATGAAGCAAGTCGGGAATGTGTTTGGCTG
AGGTTAATTACTCAACACATTCAGGAAATGTGTGGATTTCTGAAAAAGGAGATTCCGACAATATTGTTTGAAGATAATACTGCATGCATA
\
Edits in Original Sequence 
(5')XXCATAAATAAAGATCCATTTCGCCCTCATGAAAATGATGAAAAGATTCTTGGTGCTGAAACACCATATCTTAGTGCAATTGGGGC
ATTAATGTATCTTGCTAATAATACCCGACCAGACATTGCTTTTTCTGTAAACTTATTAGCAAGATTTAGTTCTTCCCCGACACAAAGACA
CTGGAATGGTATCAAACATTTATTCAGATACCTCCGAGGAACAATCGACAAAGGTTTGTTTTATTCAAGTGAATCCAACTTGCCACTAAT
TGGTTATGCAGATGCAGGATATTTATCAGATCCACATAAAGGTCGATCACAAACAGGCTATTTATTTACTTGTGGAGGCACAGCTATATC
ATGGCGCTCAACAAAACAGACTTTAGTTGCTACTTCCTCAAATCATGCAGAAATAATAGCTATTCATGAAGCAAGTCGGGAATGTGTTTG
GCTGAGGTTAATTACTCAACACATTCAGGAAATGTGTGGATTTCTGAAAAAGGAGATTCCGACAATATTGTTTGAAGATAATACTGCATG
CATA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan