ESTScan Details for Unigene SGN-U211094

Score 
248
Direction 
Forward
Predicted Peptide Sequence 
MALHKYSSNLIANKRWLSTNSESIQSEFTGPNAYEVLGVSERSSFAEIKDSFRKLAKETHPDLAPNSNHNSKQFVEILAAYEILSDSEKR
AHYDQYLSSRRTLVHTTLDKVLKMCMYDSYSTTVKEMEVVEWLRWYRQTVNDILAEQRVVSGSGYFDELERDFYSALHLAFYGX
Predicted Coding Sequence 
ATGGCATTACACAAATATTCTTCCAATTTAATTGCAAACAAGCGGTGGTTAAGTACAAATAGTGAATCAATTCAATCAGAATTTACGGGA
CCCAACGCTTATGAAGTATTAGGTGTATCAGAAAGAAGTTCATTTGCTGAAATTAAAGACTCTTTTCGTAAATTGGCTAAGGAAACTCAC
CCTGATCTTGCTCCTAATTCCAATCACAATTCTAAACAATTCGTCGAAATTCTTGCTGCTTATGAGATTCTATCTGATTCTGAGAAGAGG
GCACATTATGACCAGTATCTATCATCAAGAAGAACACTTGTCCACACCACACTAGACAAGGTTCTXAAAATGTGCATGTATGACTCATAT
AGCACGACAGTCAAGGAGATGGAAGTCGTTGAATGGTTAAGGTGGTATAGGCAAACCGTAAATGACATATTGGCTGAACAAAGGGTAGTA
TCTGGATCAGGCTATTTTGATGAACTGGAAAGAGATTTCTACTCAGCGTTACATTTAGCTTTTTATGGCCXX\
Edits in Original Sequence 
CTTGGCAACTCCGTAATAATCCCAGAAATGAAACTCTTAACCATTTCTCTTCACTCTCTCTACAATCATCAATTTCTATTTCATACAATT
TTTCCTCTATCAAATTAC
(5')ATGGCATTACACAAATATTCTTCCAATTTAATTGCAAACAAGCGGTGGTTAAGTACAAATAGTGAATC
AATTCAATCAGAATTTACGGGACCCAACGCTTATGAAGTATTAGGTGTATCAGAAAGAAGTTCATTTGCTGAAATTAAAGACTCTTTTCG
TAAATTGGCTAAGGAAACTCACCCTGATCTTGCTCCTAATTCCAATCACAATTCTAAACAATTCGTCGAAATTCTTGCTGCTTATGAGAT
TCTATCTGATTCTGAGAAGAGGGCACATTATGACCAGTATCTATCATCAAGAAGAACACTTGTCCACACgCACACTAGACAAGGTTCTXA
AAATGTGCATGTATGACTCATATAGCACGACAGTCAAGGAGATGGAAGTCGTTGAATGGTTAAGGTGGTATAGGCAAACCGTAAATGACA
TATTGGCTGAACAAAGGGTAGTATCTGGATCAGGCTATTTTGATGAACTGGAAAGAGATTTCTACTCAGCGTTACATTTAGCTTTTTATG
GCCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan