ESTScan Details for Unigene SGN-U211147

Score 
152
Direction 
Reverse
Predicted Peptide Sequence 
ETEMFSDLVFTKLCTPLFIMXNVFLSSALPEDEWFTETAKGAINKLLLGGSGSDTSEIDDEHIIMHDGGISDSDGSPSSLSSVDSSESFA
SAQMGDLDSPVYFSDPES
Predicted Coding Sequence 
XCCGAAACCGAAATGTTCAGTGATTTGGTTTTTACAAAATTATGCACTCCCTTATTTATCATGGANAATGTCTTTCTCAGCAGTGCCCTA
CCCGAGGACGAATGGTTCACAGAAACTGCAAAAGGAGCCATAAACAAGCTTCTTTTAGGTGGTTCTGGATCAGATACATCGGAAATTGAT
GATGAACACATCATTATGCATGATGGGGGGATTTCGGACTCTGATGGATCGCCTTCTTCCCTCTCAAGTGTAGATAGTTCCGAGTCATTC
GCTTCAGCGCAAATGGGTGATCTGGATAGTCCTGTGTATTTCTCTGATCCAGAGAGTTAA\
Edits in Original Sequence 
(5')XCCGAAACCGAAATGTTCAGTGATTTGGTTTTTACAAAATTATGCACTCCCTTATTTATCATGGANAATGTCTTTCTCAGCAGTGC
CCTACCCGAGGACGAATGGTTCACAGAAACTGCAAAAGGAGCCATAAACAAGCTTCTTTTAGGTGGTTCTGGATCAGATACATCGGAAAT
TGATGATGAACACATCATTATGCATGATGGGGGGATTTCGGACTCTGATGGATCGCCTTCTTCCCTCTCAAGTGTAGATAGTTCCGAGTC
ATTCGCTTCAGCGCAAATGGGTGATCTGGATAGTCCTGTGTATTTCTCTGATCCAGAGAGTTAA\(3')ACTATGACGTCGAAATACTTC
CAGCGACTTGTATTTAAGAGTTGTATCTGTTACTAGTGCATGTGTTAGGTTAGGATGGTAGGATATATGAAGTAATAGTTCTCAGTTCTG
TTGAATTCATACAGTAGCGACATTATTATCAACTAACTAGGTATTAAGGAGTTACGCTGGAAGATTCTTTAAAAAAAATTATTACATATA
GAGAGATTAGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan