Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U211168

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
NTSKWIEEVRTERGSDVIIVLVGNKTDLVAKGKFPXEEGGAEAREVGVMYIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVN
LKPTTNTSHTEQQGGGCAARFIXTKEEEKDIELGKTQRCSCILLLGCSISKFT
Predicted Coding Sequence 
XXGAACACTTCAAAGTGGATTGAGGAAGTACGAACTGAACGGGGCAGTGATGTCATTATTGTTCTTGTTGGGAACAAAACCGATCTTGTT
GCTAAAGGCAAGTTTCCAXCAGAAGAAGGAGGTGCTGAGGCTCGTGAAGTTGGAGTAATGTATATAGAAACCAGTGCTAAAGCTGGATTC
AATATCAAGCCTCTGTTTCGAAAGATTGCTGCTGCATTACCAGGGATGGAAACACTTTCATCCACAAAACAGGAAGATATGGTTGACGTT
AATTTAAAGCCTACCACAAATACATCCCATACAGAGCAGCAAGGTGGAGGTTGTGCTGCTAGATTCATTGXTACTAAAGAGGAGGAGAAA
GACATCGAACTTGGAAAAACACAAAGATGCAGTTGCATTTTGTTGTTAGGGTGTTCAATTAGCAAATTTACTTAG\
Edits in Original Sequence 
(5')XXGAACACTTCAAAGTGGATTGAGGAAGTACGAACTGAACGGGGCAGTGATGTCATTATTGTTCTTGTTGGGAACAAAACCGATCT
TGTTGaCTAAAGGCAAGTTTCCAXCAGAAGAAGGAGGTGCTGAGGCTCGTGAAGTTGGAGTAATGTATATAGAAACCAGTGCTAAAGCTG
GATTCAATATCAAGCCTCTGTTTCGAAAGATTGCTGCTGCATTACCAGGGATGGAAACACTTTCATCCACAAAACAGGAAGATATGGTTG
ACGTTAATTTAAAGCCTACCACAAATACATCCCATACAGAGCAGCAAGGTGGAGGTTGTGCaTGCTAGATTCATTGXTACTAAAGAGGAG
GAGAAAGACATCGAACTTGGAAAAACACAAAGATGCAGTTGCATTTTGTTGTTAGGGTGTTCAATTAGCAAATTTACTTAG\(3')ATTA
TGAGGTTTGCAACAATTTGTTATGACTCCATAAAGAAGGTAGCTGACAACACGGTTTTGTTAGTATCATCACATTTTTGTTTAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan